KEGG   Seonamhaeicola sp. S2-3: BWZ22_05515Help
Entry
BWZ22_05515       CDS       T04683                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
seon  Seonamhaeicola sp. S2-3
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:seon00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BWZ22_05515
  Amino acid metabolism
   00310 Lysine degradation
    BWZ22_05515
   00380 Tryptophan metabolism
    BWZ22_05515
Enzymes [BR:seon01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BWZ22_05515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1162466..1165204)
Genome map
AA seq 912 aa AA seqDB search
MDKFSFLNAAHTAYFADLYEQYLQNPDSVEPSWRAFFQGYDFGSENYGLDGEIVEGVSAQ
MPEHLQKEFQVVKLIDGYRMRGHLFTKTNPVRERRTYTPTLELKNFGLSENDLDTVFNAG
EILGLEAQPLREIIKHLELTYCDTIGVEYMYLRNPEVIKWWQEKLNLNDNHPTYSADTKK
YILSKLNQAVNFENFLQTKYVGQKRFSLEGGETLIPAISNTLYNAVEKYGVKETVLGMAH
RGRLSTLVNIFRKPLNELFSEFEGKDFEDQDIDGDVKYHLGLTLDKTYQNGKTIKMNLVP
NPSHLETVGPVAEGITRAKIDSDYGGDDSKILPIIVHGDAAIAGQGIVYEVAQMSQLNGY
KTGGTIHIVVNNQIGFTTNYLDARSSTYCTDVAKVTLSPVMHVNADDAEAVVHAIEMALD
YRMRFKKDVYIDLLGYRKYGHNEGDEPRFTQPKLYKNIARHPNPFKIYSDKLIAEGTVDK
AYVDSIVSEFKNTLESEYEKAKEAESSKVREFMQERWANFKRRGLDAMLEPAETKYPENN
LKSISKVVSTVPEGVKFLRKAERILQGRQKMVFETDTLDWGMAETLAYGSLLEEGFNVRI
SGQDVERGTFSHRHAILRDEISEERINLLNTNPNNKGEMYIYNSSLSEYGVLGFDYGYAM
ANPNTLTIWEAQFGDFSNGAQIIFDQYLSAAEDKWKVQNGVVVLLPHGYEGQGSEHSSAR
MERYLQLCANDNMIVADCTTPANFFHLLRRQMKRDFRKPLIVFTPKSLLRHPKAVSSIKE
LATGEFQEVIDDTINPDKVKKLVFCTGKFYYELLTERETLNRDDVAIVRIEQLFPLHLEK
IQQIIDKYPNVEKYIWAQEEPRNMGAWSFMAQRLDLVKLEACTRNYNSVPAPGSSARDKA
RQRKVLENVFSI
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atggataaattttcctttttaaacgcagcacacacagcgtattttgctgatttgtacgag
cagtatttgcaaaaccctgatagtgtagaacctagttggagagccttttttcaagggtat
gattttggtagtgaaaactacgggttagatggtgaaattgttgaaggtgtatcggctcaa
atgccagagcatttacaaaaagaatttcaagtagttaaacttattgatgggtacagaatg
cgagggcatttgtttacaaaaactaatcccgtaagagaaagacgcacctataccccaacc
ttagaattaaaaaattttggtctttccgaaaacgatttagataccgtttttaatgccgga
gaaattcttggtttagaagcgcagcctttaagagaaattataaaacaccttgaattaact
tattgtgatacaattggtgtagaatatatgtatttgcgtaacccagaggttattaaatgg
tggcaagaaaagcttaacttaaacgataatcaccctacgtattctgcagatactaaaaaa
tatatactctctaaacttaatcaagcggttaatttcgagaactttttgcaaactaaatac
gttgggcaaaaacgtttttcgttagaagggggtgaaacactaataccagccataagtaat
acgctttacaatgctgtagaaaaatacggagttaaagaaaccgtattaggaatggcgcat
cgtgggcgtttaagtaccttggttaatatttttagaaagccattaaatgaattatttagt
gagtttgaaggaaaagattttgaagatcaagatattgatggtgatgtaaaatatcactta
ggcttaacattagataaaacctatcaaaacggtaaaactattaagatgaatttggtgcca
aatccatcacatttagaaaccgttggtcctgttgcagaaggtattacaagagcaaaaata
gatagcgattatggtggagatgattctaaaattctacctattatagttcatggagacgcc
gctattgcaggtcaaggaatagtttatgaagtggctcaaatgagtcagttaaacggttat
aaaactggcggaaccattcatattgtagtaaataatcaaataggatttacaaccaattat
ttagatgcacgttctagtacctattgtacagatgttgccaaagtaacattgtctcctgta
atgcacgtaaatgccgatgatgctgaagctgttgtacatgcaattgaaatggcgctagat
tacagaatgcgttttaaaaaagatgtatatatagatttattaggttacagaaaatatggt
cataacgaaggagatgaacccagatttacacaacctaaactgtataaaaatatagcaaga
caccctaatcctttcaaaatatattcagataaacttattgcagaaggaacggtagataaa
gcatatgtagatagtattgtaagtgagtttaagaacacgcttgaaagtgagtatgaaaag
gctaaagaggcagaatcctctaaagttagagagttcatgcaagaacgttgggcaaatttt
aagcgtagaggcttagatgcaatgctagaaccagcagaaacaaaatatccagaaaataat
ttaaagtctatctcaaaagtagtttcaacagtaccagaaggtgttaagtttttacgtaaa
gcagaacgaattttacaaggacgccaaaagatggtttttgaaactgatacattagattgg
ggaatggcagaaacattagcttatggaagcttattagaagaaggatttaatgttagaatt
tctgggcaagatgttgagcgcggtaccttcagtcaccgtcatgctattttacgtgatgaa
atttcagaagaacgtatcaatttattaaacaccaaccccaataataaaggcgaaatgtat
atctacaattcgtccctttcagaatacggtgtattaggatttgattatgggtacgccatg
gcaaatccaaacacattaaccatttgggaagcacagtttggagattttagtaacggagca
caaattatattcgatcaatatttatcagcagctgaagataaatggaaagtacaaaatggg
gttgtagtactattgcctcatggttatgagggacaagggtctgagcattcttccgcaaga
atggaacgttacttacaactttgtgctaatgataatatgatagtagccgactgtaccacg
cctgcaaactttttccatttattacgccgacaaatgaaacgtgattttagaaagccgttg
attgtttttacccctaaaagtttattaaggcatccaaaagcagtttcctcaattaaagaa
ttagctaccggagaatttcaagaagttatagatgacactataaacccagataaggttaaa
aaattagttttctgtacaggtaaattctattatgagctattaactgagcgtgaaacttta
aatagagatgatgtagctattgtgagaatagaacaactatttcctcttcatttagaaaag
attcaacaaattattgataaatatcctaatgttgaaaaatacatttgggctcaagaagaa
ccaagaaacatgggggcttggagttttatggcacaacgattagatttagttaaattagaa
gcttgtaccagaaattataactcggttcctgcaccaggttctagcgctagagataaagca
agacagcgtaaagttttagaaaacgttttcagtatttaa

DBGET integrated database retrieval system