KEGG   Streptococcus equi subsp. zooepidemicus H70: SZO_05310Help
Entry
SZO_05310         CDS       T00871                                 

Definition
(GenBank) glycosyl hydrolase family protein
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
seq  Streptococcus equi subsp. zooepidemicus H70
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:seq00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SZO_05310
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SZO_05310
Enzymes [BR:seq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     SZO_05310
Bacterial toxins [BR:seq02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   SZO_05310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
612797..617437
Genome map
AA seq 1546 aa AA seqDB search
MLFNPIGKEQIRKYAIKKLSVGVASVCVGIGLAAGLPVVVYADDVSEVSLQQPTKAAVTE
ISHEQEPQATDTDSEALVVSEETTVDEAVVANAVTSNAADQTADEEKSNAPVELNKVANG
GFDNDYVSNKNQWQYREGGHSVLTTENNNSYAEVTSGTLDEHILQKVSTTVGKTYTLEAD
VKVEADTPHNGLYLTAKESNHNLQGPVIKEVSLTDTDGTWSHIKLSFTATTSETFVGLVK
RLEASSPETLAASASIDNVSVVEENDYELIWQDEFSGDQLNQENWGYELGSIRGNEQQHY
TDSTENIYLENGNLVLNVTERKGEDRYANPRGGTSARQVIYDSGSVRTVGKQEFLYGRIE
ARAKLPKGKGAFPAFWTLGADFTLDGDIASTQGYGWPSTGELDIMELIGAPNGEHEGELA
EGDQSNKTVYGTPHFYYVKGDADKDGSYSPTALGGNLTLSDDFYDDYHIFGINWYPDKIE
WYVDGIVYNTMYLTGDERLEAAAAAFNKPQYLQFNLATGGNWSKNAGYYLASDETAFVID
YVRYYQDAEQKAASEAYYASQPDLKGVKDLTMLEGTSPDLAQAVTTDQEGYVVDFSVENE
YLFTNKGGNTNAALQAAGRDDLSALSELAPGIYNIYYSAVPYNADLGSTVTPTAKIAREV
AILTVLPKEGLIGKKGEPLSTVALPANWQWVTPEEILGSAEHYQIKYTTEGGRAIYTSIE
ASYISDQPISDQASILVDLGNAILDATAEKAAVTDDEALSKLDDVMSLNQGTVTIRYRLD
TADTTVRSSSPLALLSISNQASANEYASFFIEPKNNKIGLEFKGAEVPIVKVGSGFNLLT
NSDWQTISYVFTGSRLKIYLNGDLYGEADFAGFMKQLPWKASADTLTIGGLKRTYDGESV
LHWGLKGLVDQVLIDTDVYDLTDIAKAHQSTLRPVTGEKTNVWDKYDEGVFEYRIPSVVK
TPSGTLIAAADARKKHYNDWGDVATVVRISHDDGKTWSNNITVLDMPTQPYFTTQYSLAD
WNTNMTQSAFSIDSTLLTDASGKLYLLVDVFPESQGAVASKAGSGYELINGQYYLNLYDF
DNNKYTVREGGIVYDQNGHQTDMYVDEGNFETAFSTRGNLYQTEAGEDILLGNIYLRSGR
TKQGITREGSQTAPLFTYMTSFLWLLTSEDEGQTWSTPLDITPQIKEDWMGFLGTGAAAG
IEIDAVNAEGEQVKRLVFPIYYTNQQNATSASLGRQSSANIFSDDGGQTWQRGESPNDGR
IYGHNQQTTSKDFDTSVTELTENQIIQLNNGHLLQFMRNTGKTIVIARSTDYGATWEDNP
TVTDLPEPYVNLSAIHMMVDGKEYVVLSNPLGEPSGEQLTIRNQRMKGILRVGEVLEDDS
INWVASTIFEPKRFAYSSLVQLDDERVGLLYEYSGQITYSTFNIKQMISDQFREDKAEIE
EVTITSAAPKQNGKASITIQMTFNQPMFILGDRQLAVTVNGVDKLASYVSGDGTDTAIFE
LSLESMPEGPITVLPQFDHTIVETKYGIRLTDDKAYTVSYPAAVTA
NT seq 4641 nt NT seq  +upstreamnt  +downstreamnt
atgttatttaatcctatcggaaaagagcaaattagaaaatatgccatcaaaaagcttagt
gtcggtgttgcttcagtgtgtgtgggtattggtcttgctgctggtctgccagtggttgtt
tatgctgatgacgtttcagaggtaagcctacagcagcctacgaaagcagcagtaacagag
ataagccatgagcaggagcctcaagctacagatacagatagcgaggccttagtagtctca
gaggagacgacagtagatgaggcagtagtagctaatgctgtgaccagcaatgctgctgat
cagacagcagacgaagagaagtctaacgctcctgttgagctcaacaaggtggctaatggt
ggttttgataatgattatgtgtccaataagaatcagtggcaatatagagagggaggtcat
tcagtccttacaacagagaataataatagctatgctgaggtaacaagcggcactttagat
gagcatatccttcaaaaggtgtctacaacggttgggaaaacctatacgctagaggctgat
gtgaaggttgaagctgacacacctcataatggcttataccttaccgctaaagagtccaat
cacaatcttcagggccctgttatcaaagaggtcagcctcacagatacagacggtacttgg
tcacatatcaagctctcctttacagcaacgacttcagaaacctttgttggcttagtcaaa
cggttggaagcttcttcaccagaaaccttggctgcctctgctagtattgacaacgtgagt
gtcgtagaggaaaatgattatgaattgatttggcaggatgagttttcaggagatcagctc
aatcaggagaactggggatatgaattgggaagtattcgcgggaatgaacagcagcactac
acagacagcacagagaatatttatcttgaaaatggtaatcttgttttaaatgtcacagag
cgtaaaggtgaggaccgttatgccaatcctagaggaggaacaagcgcacgtcaggtcatt
tatgattccggtagtgtacgaacggttggcaagcaagaatttttatatggtcgtatcgaa
gctagggccaagcttcccaagggtaagggagcctttccagccttttggacattgggggct
gattttaccttagatggtgatattgcgtcaactcaaggctatggctggccaagcacaggt
gagcttgatattatggagctaatcggtgctcctaacggtgagcatgagggtgagcttgcc
gaaggcgatcaaagcaacaagacggtttatgggactccccatttttactatgtcaagggt
gatgcggacaaagatggaagctatagcccaacagcattgggtggcaatctgacattaagt
gatgacttttatgatgactaccatatctttggtattaattggtatccggataagattgaa
tggtatgttgatgggattgtttacaacaccatgtatttaaccggtgatgaacgcttagag
gctgccgcagctgcctttaataagcctcaataccttcagtttaaccttgctactggaggc
aattggagtaaaaatgcaggctattatttggcttcagatgagacagcctttgtgattgat
tatgtgcgttattatcaagacgctgagcaaaaagcagcttcagaagcctactatgcctca
cagccagacctcaagggagtcaaggacttaacgatgctagaaggcaccagtcctgattta
gctcaagctgtaaccactgaccaggaagggtatgtggttgatttttcagttgaaaatgaa
tatttgtttactaacaagggtggaaataccaatgctgctttacaggctgctggtcgagat
gatttgtcagccttgtctgagctagctcctggtatttataacatttactatagtgctgtt
ccttacaatgctgatttaggctcaacagtaacaccaactgctaagattgcaagagaagta
gctattttaactgtattacctaaagaaggtctgattggtaagaagggagaacccttatct
acagtagccctgccagccaattggcaatgggttacgccagaggagatcttgggaagtgca
gagcattatcagatcaaatacaccacagaaggcggacgagctatttatacaagcatagaa
gcaagctatatctcagatcagccaatctcagatcaagcatccattttagttgatttaggc
aatgctattttggacgcaacggcagaaaaagcagccgtaacagatgacgaggctcttagc
aagctagatgatgtgatgagcttaaatcaaggaacagtaacaatcaggtaccgcctagat
actgctgatacaacagtgagaagctcatcgcccttggccttgttatcgatctcaaatcaa
gcatcagctaatgaatacgcctctttctttatcgagcctaaaaacaataaaataggtctt
gaatttaaaggagctgaggttccgattgtaaaagttggctcaggctttaatttattaacg
aactcggactggcagacgatcagctatgtctttacagggtctaggctaaagatttacttg
aatggtgacttatatggggaagctgactttgctgggtttatgaagcaattaccttggaag
gcttctgctgatacgctaacaattggaggcttgaaacgcacctatgatggtgagtcggtc
cttcattgggggctaaagggattggttgatcaggtgctgattgatacagatgtgtatgat
ctgacagatattgctaaggcacaccagtcaacccttcgaccagttactggtgaaaagacg
aatgtttgggataaatatgatgaaggtgtctttgaatatcggattccctctgttgtcaaa
acgccatcaggaaccttgatagccgcagcagatgcaagaaagaagcactacaatgactgg
ggagatgttgcaactgttgtcaggataagccatgatgatggcaaaacctggagtaataac
attacggtcttagacatgccaactcaaccttattttacaacacaatatagcttggctgat
tggaataccaacatgactcaatctgctttttcaatagactccaccttgctaacagatgct
tctggcaagctttatttgctggtagatgtctttcctgagtcacagggtgctgttgcttct
aaagcaggctcaggatatgaattgattaacggtcagtattatttaaatctttatgatttt
gacaataataaatacactgtacgtgaaggtggtatcgtctatgaccagaatggccatcag
acagatatgtatgttgatgagggcaattttgagacagcctttagcacacgcggcaacctc
tatcaaacagaggcaggagaggatattctactagggaatatttatctgagaagtggtcgc
actaagcaaggcatcactagagaaggctcacaaacagctcctctatttacttacatgacc
agctttttatggctgctaaccagtgaagacgaagggcaaacctggtccacacctcttgat
attactccacaaataaaagaagactggatgggatttttaggtacgggtgccgcagctggc
attgaaatagacgcagtcaatgcagagggtgagcaggtgaaacggttagttttcccgatt
tactataccaatcaacaaaatgcgacatcagctagtctaggtcgtcaaagcagtgctaat
atttttagtgatgatggcggtcaaacatggcaacgaggtgaatcaccaaatgatggcaga
atttatggtcataaccaacaaacaacctctaaggattttgatacatcagtcacagaattg
acagaaaatcaaatcattcagctaaacaatggtcacttattacagtttatgcgcaatacc
ggaaagacaatcgttattgccagaagcacagactatggtgcaacctgggaggataatcca
accgtcacagatctaccagagccatatgttaatctatcagctattcacatgatggttgat
ggcaaggaatatgttgtcttatcaaatcctttaggagagccttcaggtgagcagctgaca
attagaaatcaacgcatgaaagggattttacgtgtcggcgaggtgttagaggacgacagt
attaattgggtggcttcaaccatttttgagccaaaacgttttgcttattctagcttggtt
caactagatgatgagagggttggtttattatacgaatacagtggtcagatcacctattca
acctttaatatcaagcagatgatctcagaccagtttcgtgaggataaggctgaaattgaa
gaagtaacaataacgtcagcagctccaaagcaaaatggcaaagcaagcataaccattcag
atgacctttaatcaaccgatgtttattcttggtgatcgtcagttagcagttactgtaaat
ggcgtagataagcttgccagctatgtttcaggagatggcacagacacagcgatatttgaa
ttgtctctggagagtatgcctgaaggaccgataactgttttaccgcagtttgaccatact
attgttgaaaccaaatacggcattagattgacagatgacaaggcatacactgtctcttat
cctgctgctgtgacagcatag

DBGET integrated database retrieval system