KEGG   Streptococcus equi subsp. zooepidemicus CY: Q426_01975Help
Entry
Q426_01975        CDS       T03306                                 

Definition
(GenBank) sialidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
sequ  Streptococcus equi subsp. zooepidemicus CY
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sequ00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Q426_01975
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Q426_01975
Enzymes [BR:sequ01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     Q426_01975
Bacterial toxins [BR:sequ02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   Q426_01975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
390045..394685
Genome map
AA seq 1546 aa AA seqDB search
MLFNPIGKEQIRKYAIKKLSVGVASVCVGIGLAAGLPVAVYADDVSEVSLQQPTKAAVTE
ISHEQEPQATDTDSEALVVSEETTVDEAVVANAVTSNAADQTADEEKSNAPIELNKVANG
GFDNDYVSNKNQWQYREGGHSVLTTENNNSYAEVTSGTLDEHILQKVSTTVGKTYTLEAD
VKVEAATPHNGLYLTAKEANHNLQGPVIKEVSLTDTDGTWSHIKFSFTATTSETFVGLVK
WLEASSPETLAASASIDNVSVVEENDYELIWEDEFSGDQLNQENWGYELGSIRGNEQQHY
TDSTENVYLENGNLVLNVTERYGEDRYANPRGGTSARQVIYDSGSVRTVGKQEFLYGRIE
ARAKLPKGKGAFPAFWTLGADFTLDGDIASTQGYGWPSTGELDIMELIGAPNGQHEGEIA
EGDQSNKTVYGTPHFYYVNGDADKDGSYSPTALGGNLTLSDDFYDDYHIFGINWYPDKIE
WYVDGIVYNTMYLTGDERLEAAATAFNKPQYLQFNLATGGNWSKNAGYYLASDETAFVID
YVRYYQDAEQKAASEAYYASQPVLKGVKDLTMLEGTSPDLAQAVTTDQEGYVVDFSVENE
YLFTNKGGNTNATLQASGRNDLAALSELAPGIYNIYYSAVPEAANLGSTVTPTAKIAREV
AILTVLPKEGLYGQKGEPLSTVALPANWQWVTPEEILGSAEHYQIKYTTEGGRAIYTSIE
ASYISDQPISDQASILVDLGNAILDATAEKAAVTDDEALSKLDDVMSLNQGTVTIRYRLD
TADTTVRSAAPLALLSISNQASANEYASFFIEPKNNKIGLEFKGAEVPIVKVGSGFNLLT
NSDWQTISYVFTGSRLKIYLNGDLYGEADFAGFMKQLPWKAAADTLTIGGLKRTYDGESV
LHWGLKGLVDQVLIDTNVYDLTDIAKAHQSTLRPVTGEKTNVWDKYDEGVFEYRIPSVVK
TPSGTLIAAADARKKHYNDWGDIATVVRISHDDGKTWSNNITVLDMPTQPYFTTQYSLAD
WNTNMTQSAFSIDSTLLTDASGKLYLLVDVFPESQGAVASKAGSGYELINGQYYLNLYDF
DNHKYTVREEGIVYDSNGKKTDMYVDEGNFETAFSTRGNLYQTGAGEDILLGNIYLRSGR
TKQGITREGSQTAPLFTYMTSFLWLLTSEDEGQTWSTPLDITPQIKEDWMGFLGTGAAAG
IEIDAVNAEGEQVKRLVFPIYYTNQQNATSASLGRQSSANIFSDDGGQTWQRGESPNDGR
IYGHNQQTTSKDFDTSVTELTENQIIQLDNGHLLQFMRNTGKTIVIARSTDYGATWDDNP
TITDLPEPYVNLSAIHMMVDGKEYVVLSNPLGEPSGEQLTIRNQRMKGILRVGEVLEDDS
IDWVASTIFEPKRFAYSSLVQLDDERVGLLYEYSGQITYSTFNIKQMISDQFREDRAEIE
EVTITSAVPKQSGKASITIQMTFNQPMFILGDRQLAVTVNGVDKLASYVSGDGTDTAIFE
LSLESMPEGPITVLPQFDHTIVETKYGIRLTDDKTYTLSYPDPATA
NT seq 4641 nt NT seq  +upstreamnt  +downstreamnt
atgttatttaatcctatcggaaaagagcaaattagaaaatatgccatcaaaaagcttagt
gtcggtgttgcttcagtgtgtgtgggtattggtcttgctgctggtctgccagtggctgtt
tatgctgatgacgtttcagaggtaagcctgcagcagcctacgaaagcagcagtaacagag
ataagccatgagcaggagcctcaagctacagatacagatagcgaggccttagtagtctca
gaggagacgacagtagatgaggcagtagtagctaatgctgtgaccagcaatgctgctgat
cagacagcagacgaagagaagtctaacgctccgattgagctcaacaaggtggctaatggt
ggttttgataatgattatgtgtccaataagaatcagtggcaatatagagagggaggtcat
tcagtccttacaacagagaataataatagctatgctgaggtaacaagcggcactttagat
gagcatatcctccaaaaggtgtctacaacggttgggaaaacctatacgctagaggctgat
gtgaaggttgaagctgctacgcctcataatggcttataccttactgctaaagaggccaat
cacaatcttcaaggccctgttatcaaagaggtcagcctcacagatacagacggtacttgg
tcacatattaaattctcctttacagcaacgacttcagaaacctttgttggcttagtcaaa
tggttggaagcctcttcaccagaaaccttggctgcctctgctagtattgataacgtgagt
gtcgtagaggaaaatgattatgaattgatttgggaggatgagttttcaggagatcagctc
aatcaggagaactggggatatgaattgggaagtattcgcgggaatgaacagcagcactac
acagacagcacagagaatgtttatcttgaaaatggtaatcttgttttaaatgtcacagag
cgttatggggaggaccgttatgccaatcctagaggaggaacaagcgcacgtcaggtcatt
tatgattcaggaagcgtacgaacggttggcaagcaagaatttttatatggtcgtatcgaa
gctagggccaagcttcccaagggtaagggagcctttccagccttttggacattgggggct
gattttaccttagatggtgatattgcgtcaactcaaggctatggctggccaagcacaggt
gagcttgacattatggagctaatcggtgctcctaatgggcagcatgagggggaaatagca
gagggtgatcaaagcaacaagacggtttatgggactcctcatttttactacgtcaatggt
gatgcagataaggacggcagctatagtccaactgcattgggtggcaatctgacattaagt
gatgacttttatgatgactaccatatctttggtattaattggtatccagataagattgag
tggtatgttgatgggattgtttataacaccatgtatttaacaggtgatgaacgcttagag
gcggcagctactgcttttaataagcctcaataccttcagtttaaccttgctactggaggc
aattggagtaaaaatgcaggctactatctagcttcagatgagacggcctttgtgattgat
tatgtgcgttattaccaagacgctgagcaaaaggctgcttcagaagcctattatgcctca
cagccagttctcaagggggtcaaggatttgaccatgctagagggaaccagtcctgattta
gctcaagctgtaaccactgaccaggaaggctatgtggttgatttttcagttgaaaatgaa
tatttgtttactaacaagggtgggaataccaatgccaccttgcaggcttctggacgaaat
gacttagcagctttatctgaattagctcctggtatttataatatttactatagtgcagtt
cctgaggctgctaatctaggatcaacagtgaccccaacagcaaaaattgcaagagaagtg
gctattctaacagtcttgccaaaggaagggttatatggtcaaaaaggagagcccttgtct
acagttgccctgccagccaattggcaatgggttacgccagaggagatcttgggaagtgca
gagcattatcagatcaaatacaccacagaaggcggacgagctatttatacaagcatagaa
gcaagctatatctcagatcagccaatctcagatcaagcatccattttagttgatttaggc
aatgctattttggacgcaacggcagaaaaagcagccgtaacagatgacgaggctcttagc
aagctagatgatgtgatgagcttaaatcaaggaacagtaacaatcagataccgcctagat
actgctgatacaactgtaaggagcgcagctcctttagccctgttatcgatctcaaatcaa
gcatcagccaatgaatacgcctctttctttatcgagcctaaaaataataaaataggtctt
gaatttaaaggagctgaggttccgattgtaaaagttggctcaggctttaatttactaacg
aactcggactggcagacgatcagctatgtctttacagggtctaggctaaagatttacttg
aatggtgacttatatggggaagctgactttgctgggtttatgaagcaattaccttggaag
gctgctgctgatacgctaacaattggaggcttgaaacgcacctatgatggtgagtcggtc
cttcattgggggctaaagggattggttgatcaggtgctgattgatacaaatgtgtatgat
ctgacagatattgctaaggcacaccagtcaacccttcgaccagttactggtgaaaagacg
aatgtttgggataaatatgatgaaggtgtctttgaatatcggattccctctgttgtcaaa
acgccatcaggaaccttgatagctgcagcagatgcaagaaagaagcactacaatgactgg
ggagacattgcaactgttgtcaggataagccatgatgatggcaaaacctggagtaataac
attacggtcttagatatgccaactcagccttattttacaacacagtatagcttggctgat
tggaataccaacatgactcaatctgctttttcaatagactccaccttgctaacagacgct
tctggcaagctttatttgctggtagatgtctttcctgaatcacagggcgctgttgcttct
aaagcaggctcaggatatgaattgattaacggtcagtattatttaaacctttatgatttt
gataatcataaatatactgtacgtgaggagggcattgtttacgacagtaatggcaagaag
acagatatgtatgttgatgagggcaattttgagacagcctttagcacgcgcggcaacctc
tatcaaacaggggcaggagaggatattctactagggaatatttatctgagaagtggtcgc
actaagcagggcattactagagaaggctcgcaaacagctcctctatttacttacatgacc
agctttttatggctgctaaccagtgaagacgaagggcaaacctggtccacacctcttgat
attaccccacaaataaaagaagactggatgggatttttaggtacgggtgccgcagctggc
attgaaatagacgcagtcaatgcagagggtgagcaggtgaaacggttagttttcccgatt
tactataccaatcaacaaaatgcgacatcagctagtctaggtcgtcaaagcagtgctaat
atttttagtgatgatggcggtcaaacatggcaacgaggtgaatcaccaaatgatggtaga
atttatggtcataaccaacaaacaacctctaaggattttgatacatcagtcacagaattg
acagaaaatcaaatcattcagctagacaatggtcacttattacagtttatgcgcaatacc
ggaaagacaatcgtgattgccagaagcacagattacggtgcaacctgggacgataatcct
acaatcacagacctgccagagccttatgtcaatttgtcagctattcatatgatggttgat
ggcaaggaatatgttgtcttatccaatcctttaggagagccttcaggtgagcagctgacg
attagaaatcaacgcatgaaagggattttgcgtgtcggcgaggttttagaggacgacagt
attgattgggtggcttcaaccatttttgagccaaagcgttttgcttactctagcttggtt
caactagatgatgagagggttggtttgctgtacgaatacagtggtcagatcacctattca
acctttaatatcaagcagatgatttcagaccagtttcgtgaggatagggctgaaattgaa
gaagtaaccataacgtcagcagttccaaagcagagtggcaaagcaagcataaccattcag
atgacctttaatcaaccgatgtttattcttggtgatcgtcagttagcagttactgtaaat
ggcgtagataagcttgccagctatgtttcaggagatggcacagacacagcgatatttgaa
ttgtctctggagagtatgcctgaaggaccgataactgttttaccgcagtttgaccatact
attgttgaaaccaaatacggcattagattgacagatgacaagacctataccctgtcttat
cctgatcctgctacagcctaa

DBGET integrated database retrieval system