KEGG   Streptococcus equi subsp. zooepidemicus CY: Q426_05590Help
Entry
Q426_05590        CDS       T03306                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sequ  Streptococcus equi subsp. zooepidemicus CY
Pathway
sequ00620  Pyruvate metabolism
sequ00680  Methane metabolism
sequ01100  Metabolic pathways
sequ01120  Microbial metabolism in diverse environments
sequ01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sequ00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Q426_05590
  Energy metabolism
   00680 Methane metabolism
    Q426_05590
Enzymes [BR:sequ01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Q426_05590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 Pro_dh
Motif
Other DBs
NCBI-ProteinID: AIA67818
UniProt: A0A0E1DZ63
LinkDB All DBs
Position
complement(1127227..1129998)
Genome map
AA seq 923 aa AA seqDB search
MSVKKLESYNNQEIIAEEVAILKEILESITRRMIGDEAFARIEEIIELSEKQDYVLLEQL
IAKISNKDMEFISRYFSILPLLINISEDVDLAYEINRQNNTNQDYLGKLALTIASAAEKE
NAKELLERVTVVPVLTAHPTQVQRKTVLELTNSIHNLLRRYRDVKAGVMNQNKWYSELYR
YIDILMQTDIIREKKLKVKNEITNVMQYYNSSLIQAITALTSKYKTLAKDKGILLDNPKP
INMGMWIGGDRDGNPFVTAETLRLSATVQSEVILRFYIDKLSALYQTFSLSSALTKTSPE
VERLASLSSDQSIYRENEPYRRAFHYIQARLTQTLQELIGQPASASLAATRSATVGSLRS
GAANSDDQQAPAYKTAAAFKADLVLIEQSLIAAGDSSLIEGDLQEVLQAVDIFGFFLASI
DLRQDSSVQEACVAELLKNAGIVEDYSALSEEQKCEVLLKELTEDPRTLSSAAVEKSELL
EKELAIYAAARELKDKLGEEVIKQHIISHTESVSDMFELAIMLKEVGLIDQHQARVQIVP
LFETIEDLDNARAIMTQYLSYDIVKSWIVTNAGYQEIMLGYSDSNKDGGYLASGWTLYKA
QNELTKIGEDNGVSITFFHGRGGTVGRGGGPSYEAITSQPFGSIKDRIRLTEQGEIIENK
YGNQDVAYYNLEMLISASINRMVTRMLTNPDEIDGFRKIMDEIVEDSKRIYRELVFDNPH
FYDYFFEASPIKEVSSLNIGSRPAARKTITDISGLRAIPWVFSWSQNRIMLPGWYAVGSA
FKRFIDKEEGNLAKLQHMYDKWPFFHSLLSNVDMVLSKSNMNIAFQYAQLAESKEVCEVF
HTILDEWQLTKNVILAIAQHDELLEETPSLKQSLDFRLPYFNVLNYIQIELIKRLRHEQL
DEDYEKLIHTTINGIATGLRNSG
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
ttgtcagtcaaaaaattagagagctataataatcaggagattattgctgaagaggttgct
atcctaaaggaaatacttgagagcattacgcgtcgcatgattggtgatgaggcctttgca
aggattgaggaaattatagagctatccgaaaaacaggattatgtgcttctagagcaattg
atcgctaagattagcaataaagatatggaatttatttcacgatatttttcgattcttccg
ctgttgattaatatttcagaggacgttgatttggcttatgaaatcaatcgtcaaaacaat
acaaatcaagactatctgggaaagcttgctctgaccattgcttctgctgctgaaaaggaa
aatgcaaaggaactgttggaaagggtgacagtggttccagtcttgacagcccacccaaca
caggttcagcgaaaaacagttctagagttgaccaatagcattcataaccttcttcgtcgc
tatcgtgatgtcaaagcaggtgtcatgaatcaaaacaaatggtatagtgagctgtaccgt
tacattgatattctcatgcagacggatatcattcgtgagaaaaagctcaaggtcaaaaat
gagattaccaatgtcatgcagtattacaatagctctctgatacaggcgatcacagcgctg
acaagcaagtataagacgctggccaaggacaaggggatcttgctggacaatccaaagccg
attaacatgggcatgtggatcggaggggaccgagatggcaatccttttgtcacagcagag
acactgaggctgtctgcaacagtccaaagtgaggttatcctgcgcttttacattgacaaa
ttgtcagctctttatcaaaccttttcgctgtcgtcagccttgacaaagaccagtcctgag
gtggagcgtctggccagtctatctagtgatcagtccatttatcgtgagaatgagccctac
cgcagagcttttcactatattcaggctcgtctaacccaaaccctgcaggagctaattggt
cagccggcctcagctagtctagcagccacaaggtccgctacagtaggctcacttcggtca
ggtgctgcaaattctgatgaccagcaagcaccagcctataaaacagcagcagcatttaag
gctgatctggttttaattgagcaatctctcattgcagctggggactcttctttgattgag
ggggatttgcaggaggtcctgcaagcagttgatatttttggtttctttttggccagcatt
gatttgcggcaggattctagtgtgcaggaggcctgtgttgctgagcttttgaaaaacgct
ggtattgttgaggattacagtgctttgtcagaggagcaaaaatgcgaggtcctcttaaag
gagctgacagaagacccacgcaccctctcatcggcagctgttgaaaagtcagagctatta
gaaaaggagcttgctatctatgcagcggcacgtgagctcaaggataagcttggtgaagag
gtgattaagcagcacatcatttcacatacagagagtgtttctgatatgtttgagctggct
atcatgctaaaggaggttggtctcattgaccagcatcaggcgcgcgtgcaaattgtacct
ttatttgaaacgattgaggatttggataatgctagagctatcatgacacaatatcttagc
tatgatatcgtcaagtcctggattgttacaaatgctggctatcaagagattatgcttggg
tattcagatagcaacaaggacggtggctatttagcatctggctggacactttacaaggcg
caaaatgagctgaccaaaatcggtgaggacaatggtgtcagcatcactttctttcatggt
cgtggtgggactgttggacgtggtggcggcccatcctatgaggcaatcacctcacagcca
tttgggtctattaaagaccgaatccgcctgactgagcagggtgagattattgaaaacaaa
tatggcaatcaagatgtggcttactacaacttggaaatgctgatttctgcttctatcaat
cgcatggtgactcgcatgctgacaaatcccgatgagattgatggctttaggaaaatcatg
gacgagattgttgaagatagtaagcgtatttatcgagagctggtttttgacaatccgcat
ttctatgactatttctttgaagccagtccgattaaggaggtatcaagcttaaacattggt
tctcgccctgctgctcgtaaaaccattacagacatctcaggcctgcgtgccattccttgg
gtattttcttggtcacaaaaccggatcatgcttccaggctggtatgcagtaggctctgcc
tttaagcgctttattgacaaagaagaaggaaatttggctaaattacagcacatgtatgac
aaatggcccttctttcattccttgctgtctaatgttgatatggtattgtcaaaatcaaac
atgaacattgcctttcaatatgcgcagttagcagaaagcaaggaggtctgtgaggtcttt
cataccattcttgatgagtggcagctgactaagaacgttattcttgctatcgcacagcat
gatgagcttcttgaggaaaccccgtccttgaagcaaagcttggatttccgcctcccatat
tttaatgtgttaaactacattcagattgagctgattaagcgtcttcgtcatgagcagcta
gatgaggactatgaaaagctgatccacacaactattaatggtattgctacaggacttcgt
aattccggctaa

DBGET integrated database retrieval system