KEGG   Serratia sp. SCBI: SERRSCBI_01220Help
Entry
SERRSCBI_01220    CDS       T03314                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
sers  Serratia sp. SCBI
Brite
Translation factors [BR:sers03012]
 Eukaryotic Type
  Elongation factors
   SERRSCBI_01220
 Prokaryotic Type
   SERRSCBI_01220
Mitochondrial biogenesis [BR:sers03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    SERRSCBI_01220
Exosome [BR:sers04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SERRSCBI_01220
  Exosomal proteins of breast cancer cells
   SERRSCBI_01220
  Exosomal proteins of colorectal cancer cells
   SERRSCBI_01220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
280662..281846
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPFIIVFMNKCDMVDDEELLELVEMEVRELLSAYDFPGDDLPVIRGSALKALE
GEAEWEAKIIELAEALDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVG
EEVEIVGIKDTVKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGSIK
PHTQFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNVNMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVIA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaagtttgaacgtacaaaaccgcacgttaacgtcggtactatcggccac
gttgaccacggtaaaactaccctgactgcagcgatcactaccgtactggctaaaacctac
ggcggttctgcacgtgctttcgaccagatcgataacgcaccagaagaaaaagctcgtggt
atcaccatcaacacctctcacgttgagtatgacaccccgactcgccactacgcgcacgtt
gactgcccagggcacgccgactacgtgaaaaacatgatcaccggtgctgctcagatggac
ggcgcgatcctggtagttgctgcgactgacggcccaatgcctcagacccgtgagcacatc
ctgctgggtcgtcaggttggcgttcctttcatcatcgtattcatgaacaaatgcgacatg
gttgatgatgaagagctgctggaactggtagaaatggaagttcgcgaactgctgtccgcg
tacgacttcccaggcgacgacctgccagtgatccgcggttccgcgctgaaagcgctggaa
ggcgaagctgagtgggaagcgaaaatcatcgaactggccgaagccctggacagctacatc
ccagagccagagcgtgctatcgacaagccgttcttgctgccaatcgaagacgtattctcc
atctccggtcgtggtaccgttgttaccggtcgtgttgagcgcggtatcatcaaagttggc
gaagaagttgaaatcgttggtatcaaagacaccgttaagtctacctgtactggcgttgaa
atgttccgcaaactgctggacgaaggccgtgccggtgagaacgtaggtgttctgctgcgt
ggtatcaaacgtgaagaaatcgaacgtggtcaggtactggctaaaccaggctctatcaag
ccgcacacccagttcgaatctgaagtgtacatcctgagcaaagatgaaggtggtcgtcac
acgccattcttcaaaggctaccgtccacagttctacttccgtactactgacgtgaccggt
accatcgaactgccagaaggcgtagagatggtaatgccaggcgacaacgtgaacatggtt
gtaaccctgattcacccaatcgcgatggacgacggtctgcgtttcgcaatccgtgaaggc
ggccgtactgtaggcgctggtgttgttgctaaagttatcgcttaa

DBGET integrated database retrieval system