Salmonella enterica subsp. arizonae: SARI_03487 Help Entry SARI_03487        CDS       T00627                                  Name (GenBank) hypothetical protein   KO K05787   DNA-binding protein HU-alpha Organism ses  Salmonella enterica subsp. arizonae Brite KEGG Orthology (KO) [BR:ses00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ses03032]     SARI_03487    03036 Chromosome and associated proteins [BR:ses03036]     SARI_03487    03400 DNA repair and recombination proteins [BR:ses03400]     SARI_03487 DNA replication proteins [BR:ses03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     SARI_03487 Chromosome and associated proteins [BR:ses03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     SARI_03487 DNA repair and recombination proteins [BR:ses03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       SARI_03487 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_1 HU-CCDC81_euk_2 DUF2267 Motif Other DBs NCBI-ProteinID:  ABX23312 UniProt:  A9MHC9 LinkDB All DBs Position complement(3423159..3423431) Genome browser AA seq 90 aa AA seqDB search MNKTQLIDVIADKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTG RNPQTGKEIKIAAANVPAFVSGKALKDAVK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaagactcaactgattgatgtaattgcagacaaagcagaactgtccaaaacccag gctaaagctgctctggaatccactctggctgctattactgagtctctgaaagaaggcgat gctgtacaactggttggtttcggtaccttcaaagtaaaccaccgtgctgagcgcactggc cgcaacccgcagaccggtaaagaaatcaaaatcgccgccgctaacgtaccggcatttgtt tctggtaaggcactgaaagacgcagttaagtaa

DBGET integrated database retrieval system