KEGG   Saccharothrix espanaensis: BN6_76910Help
Entry
BN6_76910         CDS       T02404                                 

Gene name
glpD
Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sesp  Saccharothrix espanaensis
Pathway
sesp00564  Glycerophospholipid metabolism
sesp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sesp00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BN6_76910 (glpD)
Enzymes [BR:sesp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BN6_76910 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_oxidored FAD_binding_2 Pyr_redox_2 Pyr_redox GIDA NAD_binding_8 HI0933_like AlaDh_PNT_C Pyr_redox_3 3HCDH_N Thi4 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: CCH34912
UniProt: K0KBI7
LinkDB All DBs
Position
8486966..8488702
Genome map
AA seq 578 aa AA seqDB search
MATRKPPAAPATPGRLGPEDRDSDWERLGSETFDLVIIGGGVVGVGAALDAATRGLRVAL
VEARDLASGTSSRSSKLFHGGLRYLEQLEFGLVREALRERELMLTRIAPHLVKPVSFLYP
LTHRVWERPYTAAGLLLYDTMGGARSVPGQKHLTRAGALRMVPALKPDALIGGIRYYDAQ
ADDARHTMMVGRTAAHYGAVVRTSTQVVAILKEADRVSGVRVRDVEDGRETDVHAHAVIN
ATGVWTDELQRLSGSRGRFRVRASKGVHIVVPRDRIVSESGMILRTEKSVLFVIPWRNHW
IVGTTDTDWNLDLAHPAATKNDIDYILDHVNTVLATPLTHNDIEGVYAGLRPLLAGESES
TSKLSREHAVARVAPGLVAIAGGKYTTYRVMGADAVDAASVDLPGRIQPSITDKVPLVGA
DGYHALVNQVDQLATRYGLHPYRVRHLLDRYGSLVHEVLESADPELLKPVPSAPDYLQVE
IVYAASHEGALHLEDALTRRTRISIEYPHRGVDCAEAVAGLMARVHGWDQERITREVEVY
TARVDAERASQTEPDDQAADAVRAAAPEARPQLTEPVG
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
gtggccacgcgcaagccgcccgcagcacccgccacgcccggccgcctgggcccggaagac
cgcgacagcgactgggagcgcctcgggtcggagaccttcgacctggtgatcatcggcggc
ggcgtggtgggcgtcggcgcggcgctggacgcggccacccggggcctgcgggtcgccctg
gtcgaggcccgtgacctggcctcgggcacgtcgagccggtcgtcgaagctgttccacggc
gggctgcgctacctggagcagctggagttcgggctggtccgcgaggcgttgcgggaacgc
gagctgatgctcaccaggatcgcaccccacctggtgaaaccggtgagcttcctctacccg
ctcacgcaccgggtctgggagcgcccgtacaccgcggcgggcctgctgctctacgacacc
atgggcggcgcgcggtccgtgccggggcagaagcacctcacccgtgcgggtgcgctgcgg
atggtcccggcgctcaagccggacgccctgatcggcggcatccggtactacgacgcccag
gccgacgacgcccggcacaccatgatggtgggccgcacggccgcccactacggcgcggtg
gtgcggacgtccacgcaggtcgtggcgatcctcaaggaggccgaccgggtctccggcgtc
cgcgtccgggacgtggaggacggccgggagaccgacgtccacgcgcacgccgtgatcaac
gcgaccggtgtctggaccgacgagctgcaacggctgtccggcagccggggccggttccgg
gtgcgggccagcaagggcgtgcacatcgtggtgccgcgcgaccggatcgtctccgagtcg
gggatgatcctgcgcacggagaagtcggtgctgttcgtgatcccgtggcgcaatcactgg
atcgtgggaaccacggacaccgattggaacctcgacctggcgcatccggcggccaccaag
aacgacatcgactacatcctggaccacgtcaacacggtcctggcgaccccgttgacgcac
aacgacatcgagggcgtctacgccggcctgcgcccgctgctcgcgggcgagagcgagtcg
acctcgaagctgtcccgcgagcacgcggtggcccgggtcgcgccgggcctggtggcgatc
gccggtggcaagtacacgacctaccgggtgatgggcgcggacgcggtggacgccgcgtcg
gtcgacctgccgggccggatccagccgtcgatcaccgacaaggtcccgctggtcggcgcg
gacggctaccacgccctggtcaaccaggtcgaccagctggccacccgctacggcctgcac
ccctaccgggtgcggcacctgctcgaccggtacggctcgctggtgcacgaggtgctggag
tcggccgacccggagctgctcaagccggtgccgagcgcgccggactacctccaggtcgag
atcgtctacgcggcctcgcacgagggcgcgctgcacctggaggacgcgctcacccggcgg
acccggatctccatcgagtacccgcaccggggcgtcgactgcgccgaggcggtcgccggg
ctgatggcccgggtgcacggctgggaccaggagcggatcacccgcgaggtcgaggtgtac
accgcgcgcgtggacgccgagcgggcgtcgcagaccgagccggacgaccaggcggcggac
gccgtccgcgcggcggccccggaggcccgtccccagctcaccgagccggtgggctga

DBGET integrated database retrieval system