KEGG   Salmonella enterica subsp. enterica serovar Enteritidis P125109: SEN3486Help
Entry
SEN3486           CDS       T00776                                 

Gene name
malS
Definition
(GenBank) alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
set  Salmonella enterica subsp. enterica serovar Enteritidis P125109
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:set00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SEN3486 (malS)
Enzymes [BR:set01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SEN3486 (malS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
3731870..3733897
Genome map
AA seq 675 aa AA seqDB search
MKLAAFALTLIPGIAIASSWTSPGFPTFSTQETGRFTSHAALTKGTRALTLHIDQQCWQP
SGAIKLNQMLSLKPCEGAPPQWRLFKDGDYTITVDTRSGTPTLLLSIKTEPERTAQLAYQ
CPVWDGSPLTLDVRQTFPEGTVVRDYYSGQTDTVQNGQITLQPADSHGLLLLERAETHAS
APFNWRNATVYFVLTDRFRNGDPTNDHSYGRHKDGMQEIGTFHGGDLRGLTSKLDYLQQL
GVNALWISSPFEQIHGWVGGGAKGDFPHYAYHGYYTQDWTTLDANMGNEADLRALVDGAH
QRGIRILFDVVMNHAGYATLEDMQEYQFGALYLSGAERQKILGDRWTNWRPAAGQSWHSF
NDYINFSDSAAWEKWWGKKWIRTDIGDYDSPGFDDLTLSLAFLPDIKTESTTPSGLPAFY
ANKPDTKAKFIEGYTPRDYLTHWLSQWVHDYGIDGFRVDTAKNVELPAWQQLKTQASAAL
HEWKQANPDKALDDSPFWMTGEAWGHGVMKSDYYRYGFDAMINFDYQEQAAKAVDCLAEM
GPVWQQMADKMQDFNVLSYLSSHDTRLFREGGDKAAELLLLSPGAVQIFYGDESARPFGP
TGSDPLQGTRSDMNWQDVSGKSAAAVAHWQRISQFRARHPAIGAGQQTTLTLKHGYGFVR
QYGDDTVMVVWAGRR
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttgccgccttcgctctgacgctgatacccggtatcgcgatcgcctcatcatgg
acctcacccggttttccgacgttctcgacgcaggaaaccgggcgctttaccagccatgct
gcattaacaaaaggtacacgcgcgttaacgctccatattgaccagcagtgctggcagccc
tccggcgccataaaactcaaccaaatgttgtcgttaaaaccctgcgaaggcgcgccaccg
caatggcgtttgtttaaagatggcgactatacgataacggtagatacccgctccggtacg
ccgaccctgttgttatcgataaaaactgaacctgagcgcaccgcgcagctcgcctaccag
tgtcccgtctgggatggttcgccgctcacgctggatgttcgccagacctttccggaaggg
acggtagtgcgcgattattacagtggtcaaaccgataccgtccaaaacgggcaaatcacg
ctgcaacctgccgacagccacgggcttttattgctggaacgcgcggaaacccatgcgtca
gcgccttttaactggcgcaacgccaccgtttattttgtgcttacggatcgctttcgcaat
ggcgatccaaccaatgaccacagctatggtcgccataaggatggtatgcaagagattggc
actttccacggcggcgatttgcgtgggttgacgagtaaactggactatctacagcaatta
ggcgtgaacgccttgtggataagctcgccgtttgaacagatccacggctgggtcggcggc
ggagcaaaaggcgattttcctcattacgcctatcacggctattacactcaggactggacg
acgctggatgccaatatgggcaacgaagccgatctccgcgcgctggtcgacggcgcgcac
cagcgcggcatccgtattttatttgacgtagtaatgaatcatgccggttacgctacgctg
gaggatatgcaggagtatcagtttggcgcgctctatttatccggcgcggaacggcaaaaa
attctcggcgatcgctggacaaactggcgacccgccgccggacaaagctggcacagcttt
aacgactacatcaacttcagcgacagcgccgcctgggaaaaatggtgggggaaaaagtgg
attcgtaccgatattggcgactacgacagtccgggatttgacgatttaaccctgtcgctg
gccttcctgccggatataaaaacggaatctaccacgccttccggtctacccgcgttctat
gccaacaaacccgatactaaagcaaagttcattgaaggctatacgccacgggattatctg
actcactggttaagccagtgggtgcatgattacggcattgacgggttccgggtcgatact
gccaaaaacgttgagcttcctgcctggcaacagctaaaaacccaggccagcgcggcgtta
catgaatggaagcaggccaatccggacaaagcgctggatgatagcccgttctggatgact
ggcgaagcgtggggccacggcgtcatgaaaagtgattattatcgctatggtttcgacgcg
atgatcaattttgattatcaggagcaggcggcgaaagcggtcgattgcctggcggaaatg
gggccagtctggcagcagatggcggataaaatgcaggatttcaacgtattaagttacctc
tcctcgcatgatacgcgccttttccgtgagggcggtgataaggcggcggaactgctgctg
ctttcgccaggcgcggtgcagatcttttacggcgatgaatccgctcgtcccttcggcccc
accggctccgacccgctgcaaggcacccgttcagatatgaactggcaggacgtgagcgga
aagtcagccgcagccgtcgcgcactggcagcgtattagccagttccgcgccagacatccc
gccatcggcgcaggccaacaaaccacgctgacgctaaaacacgggtacggttttgtacgc
cagtacggcgacgatacggtgatggtcgtctgggcgggccgccgctaa

DBGET integrated database retrieval system