KEGG   Salmonella enterica subsp. enterica serovar Typhimurium var. 5- CFSAN001921: CFSAN001921_09885Help
Entry
CFSAN001921_09885 CDS       T02737                                 

Definition
(GenBank) glutathionine S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
setc  Salmonella enterica subsp. enterica serovar Typhimurium var. 5- CFSAN001921
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:setc00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CFSAN001921_09885
Enzymes [BR:setc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CFSAN001921_09885
Transporters [BR:setc02000]
 Other Transporters
  Pores ion channels [TC:1]
   CFSAN001921_09885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2032598..2033203
Genome map
AA seq 201 aa AA seqDB search
MKLFYKPGACSLASHITLREIGKDFTLDGVDLAKKRLENGDDYLAVNPKGQVPALLLDDG
TLLTEGVAIMQYLADSVPDRQLLAPVSSLARYHTLEWLNYIATELHKGFTPLFRPDTPET
LKPAVRAGLEKKLQYVDESLSDDQWICGQRFTIADAYLFTVLRWAYGVKLNMDGLTHIES
YMQRVAKRPTVAAALKAEGLN
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttctacaaaccgggtgcctgctctcttgcttcccatattaccctgcgcgaa
attggcaaagactttacgcttgatggcgtcgatctcgcaaaaaaacgcctggaaaacggt
gatgattacctggcagtcaaccctaaaggacaggttccggctctgctgctggatgacggc
acactgttgactgaaggcgtcgccattatgcagtacctcgccgacagcgttcccgaccgc
cagcttctggcgccggtaagtagtcttgctcgctatcatacgctggaatggctcaactat
attgcaacggaactgcataaaggctttaccccgctgttccgccctgacacgccggaaaca
ctcaaacccgccgttcgcgccggtctggaaaagaaattgcagtatgtggatgagtcgctt
tcagacgaccagtggatttgcggccagcgttttaccattgcagacgcttatctgtttacc
gtattgcgttgggcctatggcgtaaaactgaatatggacgggttaacgcatattgaaagt
tatatgcagcgtgtcgcaaaaagaccgaccgttgcggcagcgcttaaagcggaaggactg
aattaa

DBGET integrated database retrieval system