KEGG   Streptococcus equi subsp. equi 4047: SEQ_1612Help
Entry
SEQ_1612          CDS       T00877                                 

Definition
(GenBank) glycosyl hydrolase family protein
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
seu  Streptococcus equi subsp. equi 4047
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:seu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SEQ_1612
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SEQ_1612
Enzymes [BR:seu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     SEQ_1612
Bacterial toxins [BR:seu02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   SEQ_1612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1619076..1623716)
Genome map
AA seq 1546 aa AA seqDB search
MLFNPIGKEQIRKYAIKKLSVGVASVCVGIGLAAGLPVAVYADDVSEVSLQQPTKAAVTE
ISHEQEPQATDTDSEALVVSEETTVDEAVVANAVTSNAADQTADEEKSNAPIELNKVANG
GFDNDYVSNKNQWQYREGGHSVLTTENGNSYAEVTSGTLDEHILQKVSTTVGKTYTLEAD
VKVEADTPHNGLYLTAKESNHNLQGPVIKEVSLTDTDGTWSHIKLSFTATTSETFVGLVK
WLEASSPEALAASASIDNVSVVEENDYELIWQDEFSGDRLNQENWGYELGSIRGNEQQHY
TDSTENVYLDNGNLVLNVTERYGEDRYANPRGGTSARQVIYDSGSVRTVGKQEFLYGRIE
ARAKLPKGKGAFPAFWTLGADFTLDGDIASTQGYGWPSTGELDIMELIGAPNGEHEGELA
EGDQSNKTVYGTPHFYYIKGDADKDGSYSPTALGGNLTLSDDFYDDYHIFGINWYPDKIE
WYVDGIVYNTMYLTGDDRLEAAAAAFNKPQYLQFNLATGGNWSKNAGYYLASDETAFVID
YVRYYQDAEQKAASEAYYASQPVLKGVKDLTMLEGTSPDLAQAVTTDQEGYVVDFSVENE
YLFTNKGGNTNAALQAAGRDDLSALSELAPGIYNIYYSAVPYNADLGSTVTPTAKIAREV
AILTVLPKEGLIGKKGEPLSTVALPANWQWVTPEEILGSAEHYQIKYTTEGGRAVYTSIE
ASYISDQPISDQASILVDLGNAILDATAEKAAVTDDEALGKLDDVMNLTQGTVTIRYRLD
TADTTVRSSSPLALLSISNQASANEYASFFIEPKNNKIGLEFKGAEVPIVKVGSGFNLLT
NSDWQTISYVFTGSRLKIYLNGDLYGEADFAGFMKQLPWKASADTLTIGGLKRTYDGESV
LHWGLKGLVDQVLIDTDVYDLTDIAKAHQPTLRPVTGEKTNVWDKYDEGVFEYRIPSVVK
TPSGTLIAAADARKKHYNDWGDVATVVRISHDDGKTWSNNITVLDMPTQPYFTTQYSLAD
WNTNMTQSAFSIDSTLLTDASGKLYLLVDVFPESQGAVASKAGSGYELINGQYYLNLYDF
DNNKYTVREGGIVYDQSGHQTDMYVDEGNFETAFSTRGNLYQTEAGEDILLGNIYLRSGR
TKQGITREGSQTAPLFTYMTSFLWLLTSEDEGQTWSTPLDITPQIKEDWMGFLGTGAAAG
IEIDAVNAEGEQVKRLVFPIYYTNQQNATSASLGRQSSANIFSDDGGQTWQRGESPNDGR
IYGHNQQTTSKDFDTSVTELTENQIIQLNNGHLLQFMRNTGKTIVIARSTDYGMTWDDNP
TITDLPEPYVNLSAIHMMVDGKEYVVLSNPLGEPSGEQLTIRNQRMKGILRVGEVLEDDS
IHWVASTIFEPKRFAYSSLVQLDDERVGLLYEYSGQITYSTFNIKQMISDQFREDKAEIE
EVTITSAAPKQNGKVSITIQMTFNQPMFILGDRQLAVTVNGVDKLASYVSGDGTDTAIFE
LSLESMPEGPITVLPQFDHTIVETKYGIRLTDDKAYTVSYPAAVTA
NT seq 4641 nt NT seq  +upstreamnt  +downstreamnt
atgttatttaatcctatcggaaaagagcaaattagaaaatatgccatcaaaaagcttagt
gtcggtgttgcttcagtgtgtgtgggtattggtcttgctgctggtctgccagtggctgtt
tatgctgatgacgtttcagaggtaagcctgcagcagcctacgaaagcagcagtaacagag
ataagccatgagcaggagcctcaagctacagatacagatagcgaggccttagtagtctca
gaggagacgacagtagatgaggcagtagtagctaatgctgtgaccagcaatgctgctgat
cagacagcagacgaagagaagtctaacgctccgattgagctcaataaggtggctaatggt
ggttttgacaatgattatgtgtccaataagaatcagtggcaatatagagagggaggtcat
tcagtcctcacaacagagaatggtaatagctatgctgaggtaacaagcggcactttagat
gagcatatccttcaaaaggtgtctacaacggttgggaaaacctatacgctagaggctgat
gtgaaggttgaagctgacacacctcataatggcttataccttaccgctaaagagtccaat
cacaatcttcagggccctgttatcaaagaggtcagcctcacagatacagacggtacttgg
tcacatatcaagctctcctttacagcaacgacttcagaaacctttgttggcttagtcaaa
tggttggaagcctcttctccggaagccttggctgcctctgctagtattgataacgtgagt
gtcgtagaggaaaatgattatgaattgatttggcaggatgagttttcaggagatcggtta
aaccaagagaactggggatatgaattgggaagtattcgcgggaatgagcagcagcactac
acagacagcacagagaatgtctatcttgataatggcaatcttgttttaaacgtcacagag
cgttatggggaggaccgttatgccaatcctagaggaggaacaagcgcacgtcaggtcatt
tatgattcaggaagcgtacgaacggttggcaagcaagaatttttatatggtcgtatcgaa
gctagggccaagcttcccaagggtaagggagcctttccagccttttggacattgggggct
gattttaccttagatggtgatattgcgtcaactcaaggctatggctggccaagcacaggt
gagcttgacattatggagctaatcggtgctcctaacggagagcatgagggtgagcttgcc
gaaggtgatcaaagcaacaaaacagtttacgggacccctcatttttactatatcaagggt
gatgcagacaaagatggaagctatagcccaacagcattgggtggcaatctgacattaagt
gatgacttttatgatgactaccatatctttggtattaattggtatccggataagattgaa
tggtatgttgatgggattgtttataataccatgtatttaaccggtgatgatcgcttagag
gctgccgcagctgcctttaataagcctcaataccttcagtttaaccttgctactggaggc
aattggagtaaaaatgcaggctactatctagcttcagatgagacggcctttgtgattgat
tatgtgcgttattaccaagatgctgagcaaaaagcagcctcagaagcttattatgcctca
cagccagttctcaagggggtcaaggatttgaccatgctagagggaaccagtcctgattta
gctcaagctgtaaccactgatcaggaaggctatgtggttgatttttcagttgaaaatgaa
tacttgtttactaacaagggtggaaataccaatgctgctttacaggctgctggtcgagat
gatttgtcagccttgtctgagctagctcctggtatttataacatttactatagtgctgtt
ccttacaatgctgatttaggctcaacagtaacaccaactgctaagattgcaagagaagta
gctattttaactgtattacctaaagaaggtctgattggtaagaagggagaacccttatct
acagtagccctgccagccaattggcaatgggttacgccagaggagatcttgggaagtgca
gagcattatcagatcaaatacaccacagaaggcggacgagctgtttatacaagcatagaa
gcaagctatatctcagatcagccaatctcagatcaagcatccattttagttgatttaggc
aatgctattttggacgcaacagcagaaaaagcagccgtaacagatgacgaggctcttggt
aagctagacgatgtgatgaacctaacccaaggaactgtaacaatcagataccgtctagat
actgctgatacaacagtgagaagctcatcgcccttggccttgttatcgatctcaaatcaa
gcatcagctaatgaatacgcctctttctttatcgagcctaaaaacaataaaataggtctt
gaatttaaaggagctgaggttccgattgtaaaagttggctcaggctttaatttattaacg
aactcggactggcagacgatcagctatgtctttacagggtctaggctaaagatttacttg
aatggtgacttatatggggaagctgactttgctgggtttatgaagcaattaccttggaag
gcttctgctgatacgctaacaattggaggcttgaaacgcacctatgatggtgagtcggtc
cttcactgggggttaaagggactggttgatcaggtgctgattgatacagatgtgtatgat
ctgacagatattgccaaggctcatcagccaacccttcgaccagttactggtgaaaagacg
aatgtttgggacaaatatgatgaaggggtctttgaatatcggattccctctgttgtcaaa
acgccatcaggaaccttgatagccgcagcagatgcaagaaagaagcactacaatgactgg
ggagatgttgcaactgttgtcaggataagccatgatgatggcaaaacctggagtaataac
attacggtcttagatatgccaactcagccttattttacaacacaatatagcttggctgat
tggaataccaacatgactcaatctgctttttcaatagactccaccttgctaacagacgct
tctggcaagctttatttgctggtagatgtctttcctgagtcacagggtgctgttgcttct
aaagcaggctcaggatatgaattgattaacggtcagtattatttaaatctttatgatttt
gacaataataaatacactgtgcgtgaaggtggtatcgtctatgaccagagtggccatcag
acagatatgtatgttgatgagggcaattttgagacagcctttagcacacgcggcaacctc
tatcaaacagaggcaggagaggatattctactagggaatatttatctgagaagtggtcgc
actaagcaaggcatcactagagaaggctcacaaacagctcctctatttacttacatgacc
agctttttatggctgctaaccagtgaagacgaagggcaaacctggtccacacctcttgat
attaccccacaaataaaagaagactggatgggatttttaggtacgggtgccgcagctggc
attgaaatagacgcagtcaatgcagagggtgagcaggtgaaacggttagttttcccgatt
tactataccaatcaacaaaatgcgacatcagctagtctaggtcgtcaaagcagtgctaat
atttttagtgatgatggcggtcaaacatggcaacgaggtgaatcaccaaatgatggcaga
atttatggtcataaccaacaaacaacctctaaggattttgatacatcagtcacagaattg
acagaaaatcaaatcattcagctaaacaatggtcacttattacagtttatgcgcaatacc
ggaaagacaatcgttattgccagaagcacagactatggtatgacttgggacgataatcct
acaatcacagacctcccagagccttatgtcaatttgtcagctattcatatgatggttgat
ggcaaagaatatgttgttttatccaatcctttaggagagccctcaggtgagcaactgacg
attagaaatcagcgcatgaaagggattctgcgtgtcggtgaggtcttagaggacgatagc
attcattgggtcgcttcaaccatttttgagccaaagcgttttgcttactctagcttggtt
caactagacgacgagagggttggtttgttatacgaatatagtggtcagatcacctattca
acctttaatatcaagcagatgatctcagaccagtttcgtgaggataaggctgaaattgaa
gaagtaacaataacgtcagcagctccaaagcaaaatggcaaagtaagcataaccattcag
atgacctttaatcaaccgatgtttattcttggtgatcgtcagttagcagttactgtaaat
ggcgtagataagcttgccagctatgtttcaggagatggcacagacacagcgatatttgaa
ttgtctctggagagtatgcctgaaggaccgataactgttttaccgcagtttgaccatact
attgttgaaaccaaatatgggattagattgacagatgacaaggcatacactgtctcttat
cctgctgctgtgacagcatag

DBGET integrated database retrieval system