KEGG   Streptomyces pratensis: Sfla_1120Help
Entry
Sfla_1120         CDS       T01647                                 

Definition
(GenBank) putative neuramidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
sfa  Streptomyces pratensis
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Sfla_1120
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Sfla_1120
Enzymes [BR:sfa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     Sfla_1120
Bacterial toxins [BR:sfa02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   Sfla_1120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1322431..1323879
Genome map
AA seq 482 aa AA seqDB search
MQRRVTLAMLSAAVMVATAAGTATGAPTAAAAAGELTSQDIATQGAGSPYYRIPALTTSV
KGTLLAAYDSRPTLGDLPGNLGIVLRRSTDGGATWQAQQVVRKEAAPKGFGDPSLLVDRT
TGRIFVFYAGSVNQGFFGSGTGNDESDPNVLQADYSYSDDDGVTWTHRRITQQIKNPAWG
GMFAASGEGIQVRNGAYKGRLIQQYAIRNNGANYAVSAYSDDHGATWRTGNPVGPGGDEN
KTVELSDGRIMLNNRSAPYRTIAYSTDGGVNYTPFAQDTALRDPANNGSVMRYAPDATAS
DPKASWLLFSNTDSSSSRSNLTVKMSCDNGRTWPIRKVVDPGSTAYSTLTRLPDGRLGLL
YERDDYTHITYSSFDLQWLGGTCADITITPPATMKAGTTTEVTVRVVNRMDVTRSAGTLD
LTVPGGWTTEQVAFPATRPGEGANIKVPVTIPAGASGNAELTVTYKADGKQASGSRTVTV
TP
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgcagagtcaccctcgccatgctctcggccgccgtcatggtggccaccgcggcc
ggtacggccaccggcgcccccaccgccgcggccgcggccggagaactcacctcccaggac
atcgcgacccagggggccggatctccctactaccgcatcccggccctgaccacctccgtc
aagggcaccctgctcgccgcctacgactcccgccccacgctcggcgacctgcccggcaac
ctgggcatcgtgctgcggcgcagcaccgacggcggggcgacctggcaggcccagcaggtg
gtccgcaaggaggccgccccgaaggggttcggcgatccgagcctgctggtggaccgcacc
acgggccggatcttcgtcttctacgccggctccgtgaaccagggcttcttcgggtcgggc
acgggcaacgacgagagcgacccgaacgtcctgcaggccgactacagctactcggacgac
gacggggtgacctggacccaccgccggatcacccagcagatcaagaaccccgcctggggc
ggcatgttcgcggcgtccggcgaaggcatccaggtgcgtaacggcgcctacaagggccgt
ctgatccagcagtacgcgatccggaacaacggcgccaactacgcggtcagcgcgtacagc
gacgaccacggcgcgacctggaggacgggcaacccggtcggtccgggcggggacgagaac
aagacggtcgagctcagtgacggccggatcatgctcaacaaccgttcggcgccctaccgg
accatcgcctactccaccgacggcggggtgaactacacccccttcgcccaggacaccgcc
ctgcgggacccggcgaacaacggctcggtgatgcggtacgccccggacgcgacggcatcg
gacccgaaggcctcgtggctgctgttcagcaacacggacagcagttcctcccggagcaac
ctcaccgtgaagatgtcctgcgacaacgggaggacctggccgatccgcaaggtcgtcgat
cccgggagcacggcgtactcgacgctgacgcgactgccggacgggcggctcggtctgctc
tacgagcgggacgactacacgcacatcacgtactcctccttcgacctccagtggctcggc
ggcacctgcgcggacatcacgatcactccgcccgccaccatgaaggcgggcaccaccacg
gaggtcacggtccgggtcgtcaaccggatggacgtgacccgcagcgccgggacactcgac
ctgacggtgcccggcggctggacgaccgagcaggtcgcgttcccggcgacacgtccgggt
gaaggcgcgaacatcaaggtcccggtcaccatcccggcgggtgcctcggggaacgccgaa
ctgaccgtgacctacaaggccgacggcaagcaggcctcggggagccgcacggtgaccgtg
accccgtaa

DBGET integrated database retrieval system