KEGG   Streptomyces pratensis: Sfla_2282Help
Entry
Sfla_2282         CDS       T01647                                 

Definition
(GenBank) aminotransferase class I and II
  KO
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sfa  Streptomyces pratensis
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sfla_2282
   00290 Valine, leucine and isoleucine biosynthesis
    Sfla_2282
   00220 Arginine biosynthesis
    Sfla_2282
Enzymes [BR:sfa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Sfla_2282
    2.6.1.66  valine---pyruvate transaminase
     Sfla_2282
Amino acid related enzymes [BR:sfa01007]
 Aminotransferase (transaminase)
  Class I
   Sfla_2282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2738263..2739474
Genome map
AA seq 403 aa AA seqDB search
MQVIQSTKLSGVCYEIRGPVLEEAMRLEAAGHRILKLNTGNPAAFGFECPPEILEDILRN
LSGAHGYGDAKGLLSARRAVMQHYQTKGIDLDVEDVYLGNGVSELIQMSMQALLDDGDEV
LVPAPDYPLWTASVSLAGGTAVHYRCDEQADWMPDLADIERKITDRTKALVIINPNNPTG
AVYDDEMLRGLTEIARRHNLVVCSDEIYDRILYDGATHTPTAAIAPDLMVLTFNGLSKNY
RIAGYRSGWMAVCGPKAHASSYIEGLTILANMRLCANMPAQHAVATALGGRQSIDELVLP
GGRILEQRDVAYDLLTRIPGVTCVKPKGALYLFPRLDLKVFKIKDDRQMVLDLLRAEKIM
VVQGTGFNWPEPDHFRVVTLPPAKDLTDAVTRIGNFLDGYSQP
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtcatccagtcaacgaagctctccggcgtctgttacgagatccgcggccccgtc
ctcgaagaggcgatgcggctcgaagccgcaggtcatcgcatcctcaagctgaacaccggg
aacccggccgcgttcgggttcgagtgcccgccggagatcctcgaggacatcctgcgcaac
ctgtccggcgcgcacggctacggcgacgcgaagggcctgctgtccgcgcgccgcgcggtg
atgcagcactaccagaccaagggcatcgacctggacgtcgaggacgtctacctgggcaac
ggcgtctccgagctgatccagatgtcgatgcaggcactgctcgacgacggcgacgaggtg
ctcgtccccgctccggactatcccctgtggacggcctcggtctcgctggccggcggcacg
gcggtgcactaccggtgcgacgagcaggccgactggatgcccgacctcgccgacatcgag
cggaagatcaccgaccgcaccaaggcgctggtgatcatcaacccgaacaatccgaccggc
gcggtctacgacgacgagatgctgcgagggctgacggagatcgcccggcgccacaacctg
gtcgtctgctccgacgagatctacgaccggatcctctacgacggcgcgacacacaccccg
accgccgcgatcgccccggacctgatggtcctcaccttcaacgggctctccaagaactac
cggatcgcgggataccgctccggctggatggcggtctgcggcccgaaggcgcacgcgtcc
tcgtacatcgagggcctgacgatcctggccaacatgcggctgtgcgccaacatgcccgcg
cagcacgcggtggccaccgcgctcggcgggcggcagtcgatcgacgaactggtgctgccg
ggcggccggatcctggaacagcgggacgtggcgtacgacctgctgacccggatccccggg
gtgacctgcgtgaagccgaagggggcgctctacctcttcccgaggctcgacctcaaggtc
ttcaagatcaaggacgaccggcagatggtcctcgacctgctgcgggccgagaagatcatg
gtggtgcagggcaccggattcaactggcccgagcccgatcacttccgggtggtcacgctg
ccgccggcgaaggacctgaccgacgcggtgacccgtatcggaaacttcctggacggctac
agccagccctga

DBGET integrated database retrieval system