KEGG   Sinorhizobium fredii USDA 257: USDA257_c05040Help
Entry
USDA257_c05040    CDS       T02188                                 

Gene name
yfcG1
Definition
(GenBank) putative disulfide bond reductase YfcG
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
sfd  Sinorhizobium fredii USDA 257
Brite
Enzymes [BR:sfd01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     USDA257_c05040 (yfcG1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
546899..547606
Genome map
AA seq 235 aa AA seqDB search
MADLSSFPITSRWPAKNPDIIQLYSLPTPNGVKISIALEELGLPYEAHRIAFDTNEQKSP
EFVSLNPNGRIPAIIDPNGPDGKPIGLFESGAILVYLAEKTGKLIPADAAGRYETLCWVM
FQMGGVGPMFGQFGHFFKFAADKVANNPYPVERYRDEAKRLLGVLEARLEGREWLMGDEY
TIADIATYPWVEGARKFYGGAEVLEYNNFPNVMTWVERGLARPAAQKGIEIPRKE
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggctgatctttcctccttcccgatcacgagccgctggccggcgaagaatcccgacatc
atccagctctactcgctgccgacgccgaacggcgtgaagatctcgattgctctggaagaa
cttgggctgccctatgaggcgcaccgcattgccttcgatacgaacgagcagaagtcgccc
gaattcgtgtcgctcaacccgaacggccgtatcccggccatcatcgatccgaacggaccg
gacggcaaaccgatcggcctgttcgaatccggtgcgatcctcgtctacctcgcggaaaag
accggcaagctcattccggccgatgcggccggccgctacgagacgctgtgctgggtgatg
ttccagatgggcggcgtcgggccgatgttcggccagttcggccatttcttcaaattcgcg
gccgacaaggtcgccaacaatccctatccggttgagcgctatcgcgacgaagcgaaacgc
ctgctcggcgttctcgaagcgcgcctcgaaggccgtgagtggctgatgggcgacgaatac
accatcgcggatatcgccacctatccgtgggtcgaaggcgcccgcaagttttatggcggc
gccgaggtgctcgagtacaacaacttcccgaacgtcatgacttgggtggagcgcggcttg
gcgcgcccggccgcgcagaagggcatcgagattccgcgcaaggaatga

DBGET integrated database retrieval system