KEGG   Sinorhizobium fredii HH103: SFHH103_02797Help
Entry
SFHH103_02797     CDS       T01731                                 

Definition
(GenBank) putative ATP-dependent DNA ligase protein
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    SFHH103_02797
Enzymes [BR:sfh01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SFHH103_02797
DNA repair and recombination proteins [BR:sfh03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     SFHH103_02797
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3010523..3013120
Genome map
AA seq 865 aa AA seqDB search
MAARSEPLSEYNRRRDFTKTREPKGAVARTHAGRKRFLVQKHDATRLHYDFRLEWEGVLK
SWAVTRGPSLNPEDKRLAIRTEDHPLAYGDFEGTIPEGEYGGGTVMLWDTGWWEPEGDPS
KGLKKGKLSFKLHGSRMKGGWALVRMRPRDGEKRENWLLVKETDEIASEDGENLIKENIT
SVVTGRAMDEIAGGKGEKRARFWHSNKSTAANLKAGAIAENDNARRRSARRPSGKLPAFK
APQLATLVTKAPAGETWLNEAKFDGYRLLCAIGGGTVRCYTRNGLDWTEKFPAIAAALAE
LDCKSALIDGEVVALSDAGPSFSALQKALRTGASTRLYAFDLIELDGKDLSREPLIERKE
KLKLLLGSLGTTATVQYSEHVEGNGEHVLAAICKAGQEGIIAKEAKAPYRSGRTRSWLKV
KCTRRQEFVIGGYTPSSKKGRPFASILVGTFEGGKLIYRGGVGTGFGEKVMQELAAAFAS
RSRETPPFDSVPRERMRNAVWLKPDLVAEVDFAEFTADGHVRHGSFEGMREDKEAKAVKL
ETAKPTGAAPGAAKSKPSAKTSKASSAKGDTDVLGIHISHPDRILFQGQGITKIDLARYY
AVVAERMLPFTADHPVSLVRCPQGGQRHCFYQKHASDGFPDEIKEVPIEESSGSTENYMY
VRHAKGLVAAVQMGTLEFHIWGATIDKLETPDRLVFDFDPDPSVDFTTVKNAAVALRDEL
ADIGLQSFALVTGGKGVHVVVPLVRRASWDDAKSFAKAVAQNIADRDPDHFVATMSKAKR
KGRIFIDWLRNERGATAIAPYSSRAREGGPIATPVGWDEMERLSGANTFHIGDILERIEA
DTDPWRDIGKVKQSLTKKMMDSVAK
NT seq 2598 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgcgcagtgaaccgctttcggaatacaatcgacgccgcgattttaccaagacg
cgcgaaccgaagggcgcagtcgctcgaacgcatgctggcaggaagcgttttctcgtccag
aagcacgacgcgacccggctgcactacgatttccgcctcgaatgggagggcgtcctgaag
agctgggccgtcacccgcggtccaagcctcaacccggaggacaagcgcctcgccatccgc
accgaggatcaccccctcgcctatggcgacttcgagggcacgataccggaaggagagtat
ggcggcggcacggtgatgctctgggataccggctggtgggagccggaaggtgacccatcg
aaaggtctgaagaagggcaagctttcgttcaagctgcatggcagccgaatgaaggggggc
tgggcgctggtgcgcatgcggccgcgcgacggcgagaagcgcgaaaactggctgctcgtc
aaggagacggacgagatcgcctccgaggacggcgagaacctgatcaaggagaacatcacc
agcgtagtgacgggccgcgcgatggacgagatcgccggcggcaagggtgaaaaacgggcg
cgcttctggcattccaacaagagcacggcggccaacctcaaggccggcgcaattgccgag
aacgataacgctcgcaggcggtcggcgcgcagaccttccggcaagctgcccgccttcaag
gccccgcagctcgcgacgctggtaacgaaagcacccgccggcgagacgtggctgaacgaa
gccaagttcgacggttaccgcctgctatgtgccatcggtggcggcactgtccgctgctac
acccgcaatggcctcgactggaccgagaagttcccggcgattgcggccgcccttgccgag
ctcgattgcaaatccgccctgatcgacggcgaggtggtggcgctgtcggacgcgggccca
agcttttcggcgctgcagaaggccctcagaaccggcgccagcacgaggctctacgccttc
gacctcatcgaactcgacggcaaggacctcagccgcgagccgctcatagagcggaaggaa
aagctgaaacttctgctcggctcgctcggcaccaccgcgaccgttcagtacagcgagcac
gtcgagggcaatggcgagcatgtgcttgccgccatctgcaaggcgggccaggagggtatc
atcgccaaggaggcgaaggcgccctatcgcagcggtcgcacccgaagctggctcaaggtc
aaatgcaccaggcgtcaggaattcgtcatcggcggctatacgccgtcatcgaagaaaggg
cggccattcgcctcgatcctcgtcggcactttcgagggcgggaaattgatctatcgtggc
ggcgtcggtaccggtttcggcgaaaaggtcatgcaggaacttgctgccgcctttgcaagc
cgcagccgcgagacaccgcccttcgacagcgtgccacgggaaagaatgcgaaatgcagtc
tggctgaagccagatctggtggcggaggtggatttcgccgaattcaccgccgacggacat
gtccgccacggctcgttcgagggaatgcgcgaggacaaggaggcaaaggccgtgaaactg
gaaacagcaaagccgacaggcgccgcgccgggggccgcgaagagcaagccttcagccaag
acgagcaaggcgtcgtctgccaagggcgataccgatgtcctcggcatccacatctcgcat
cccgaccgcatactcttccagggccagggcatcaccaagatcgatcttgcccgctactat
gccgtggtcgcggaacggatgctgcccttcaccgccgaccaccccgtttcgctggtgcgc
tgcccccagggcgggcagcggcattgtttctatcagaagcacgcgagcgacggttttccc
gacgagatcaaggaggtgccaatcgaggaatcgtcgggcagcaccgagaactacatgtat
gtgcggcacgccaaggggctggtggccgctgtgcagatgggtacgctcgagttccatatc
tggggcgcgacgatcgacaagctggaaacgcctgaccggttggtcttcgatttcgacccc
gatccgagcgtcgacttcacgaccgtgaagaacgccgctgtcgccctgcgcgacgagttg
gcggacatcggcctgcagtccttcgcgctggtgactggcggcaaaggcgtccatgtggtc
gtgccgcttgtccggcgagccagctgggacgacgcaaagagtttcgccaaggccgtggcg
cagaacatcgcagatcgcgatcccgatcatttcgttgccaccatgtcgaaggcgaagcgg
aaggggcgaatcttcatcgactggctgagaaacgagcgcggcgccacggcgatcgccccc
tattccagccgcgcccgcgaaggcggaccgatcgccacgccggtcggttgggatgagatg
gaacggctgagcggggccaacaccttccacatcggcgatattctcgagcgcatcgaagcg
gacaccgacccgtggcgcgacatcggcaaggtcaagcagtcactcacgaagaagatgatg
gattcggtcgcgaagtaa

DBGET integrated database retrieval system