KEGG   Streptococcus gallolyticus UCN34: GALLO_1034Help
Entry
GALLO_1034        CDS       T01171                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
sga  Streptococcus gallolyticus UCN34
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sga00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    GALLO_1034 (tdk)
Enzymes [BR:sga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     GALLO_1034 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1087739..1088320
Genome map
AA seq 193 aa AA seqDB search
MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRDGYGVVSSRIGMRRKAI
AITEEMDIFAFIQELPEKPYCVLIDECQFLTKKHVYDLARVVDDLDVPVMAFGLKNDFQN
ELFEGSKYLLLLADKIDEIKTICQFCSKKATMVLRTENGKPVYEGNQIQIGGNETYIPVC
RKHYFNPMISKEK
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
ttggctcaactctattataaatatggaaccatgaattctggtaagaccattgaaatttta
aaagttgctcataactatgaagaacaaggcaaacctgtcgtcattatgacttcggcactt
gatacgcgtgatggttatggtgttgtttcaagtcgtattggtatgcgtcgcaaggcgatt
gctattacggaagaaatggatatttttgcctttattcaagaattaccagaaaaaccatac
tgcgttttaattgatgaatgtcaatttttaacgaaaaagcatgtctatgatttggcgcgt
gttgttgatgatttggacgttcctgtgatggcttttgggttaaaaaatgattttcaaaac
gaattgttcgaaggctccaaatatctactgttattagcagataaaattgacgagattaaa
accatttgtcagttttgttctaaaaaagcaaccatggtcttgcgaactgaaaatggcaag
cctgtttacgaaggaaatcaaattcaaatcggtggcaacgaaacctatatccccgtttgc
cgtaaacattattttaacccaatgatttccaaagaaaaataa

DBGET integrated database retrieval system