KEGG   Streptococcus agalactiae GD201008-001 (serotype Ia): A964_1791Help
Entry
A964_1791         CDS       T02248                                 

Gene name
neu1
Definition
(GenBank) sialidase domain-containing protein
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
sgc  Streptococcus agalactiae GD201008-001 (serotype Ia)
Pathway
sgc00511  Other glycan degradation
sgc00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sgc00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    A964_1791 (neu1)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    A964_1791 (neu1)
Enzymes [BR:sgc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     A964_1791 (neu1)
Bacterial toxins [BR:sgc02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   A964_1791 (neu1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 BNR_3 BNR NCBP3
Motif
Other DBs
NCBI-ProteinID: AFS46548
LinkDB All DBs
Position
complement(1838783..1840936)
Genome map
AA seq 717 aa AA seqDB search
MVIVLGDSDSQEKLSSPLKAEIATEENRKQANLAELNVTQADNRTTYIIPESSHSIAEQQ
RFLIESKGSSVALLNSAEFRKTAGEDRGFERDKLRSLDIIPKGDLSTSNVIGNTDIASQI
SLGFKKNAIQEHHLTKTFSQKDGKLSSVIEGMLAIGKEKVEKEIKYSGNLWQKLKAKAHC
LVCCVDNLNFEDIKSYFQYYCHLNHQLKLPKGAILSAKTEVYRGGDFGRKNKDNVFGYRI
PSLLKTEKGTLLAGADERIEQACDWGNIGMVIRRSEDDGVTWGKRETIVNLRNNPRVPLV
TSGDYSGSPINMDMALVQDTSSKTKRIFSIYDMFPEGRGVISIANTPEKEYTQIGGQSYL
NLYNNGKKSKVFTIRDKGIVYNFKGKKTDYHVITETTKSDHSNLGDIYKGKQLLGNIYFT
KHKTSPFRLAKSSYVWMSYSDDDGRTWSSPRDITASLRQRGMKFLGIGPGKGIVLKWGPH
AGRIIIPAYSTNWKSHLRGSQSSRLIYSDDHGKTWHTGKAVNDNRILSNGEKIHSLTMDN
KKEQNTESVPVQLKNGDIKLFMRNLTGNLEVATSKDGGETWQNHVKRYKEIHDAYVQLSA
IRFEHDKKEYILLVNANGPGKKRQDGYARLAQVNRNGSFKWLYHHHIQDGSFAYNSVQQL
NNDQFGVLYEHREKHQNSFTLNYKVFNWSFLSQNTEKQGTLWEKMAANWHVLFKFYL
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atggtaatagtcttaggtgattctgacagtcaagaaaaattgtcatctcctctaaaagcg
gaaatagcaacagaagaaaatcgtaaacaggcaaatttagcagaactaaatgtaactcaa
gctgataatagaactacctatattatacccgaaagcagtcattccattgcagaacaacag
agattcctgatagaatcaaagggttcttcggttgcattacttaatagcgctgaatttaga
aagacagcgggagaggatagaggttttgaaagggataagttgaggtctttggatatcatt
cctaagggagatttatcgacaagtaatgtcataggtaatacggacattgctagtcagata
tcgttgggctttaaaaagaatgcgatacaggaacaccatcttactaaaacattctctcaa
aaggatggaaagttatcgtctgttatagaggggatgcttgctattggcaaagagaaagta
gagaaggaaataaaatatagtggtaatttatggcaaaaattaaaagctaaggcacactgc
cttgtttgctgtgttgataatttgaattttgaagatataaaatcttattttcaatattat
tgtcatctaaaccatcagctcaaattacctaaaggtgctatactttctgctaaaacagaa
gtatataggggaggagattttgggagaaaaaataaagataatgtgtttggttaccgtatc
ccctcattattaaaaacggaaaaaggaactttacttgcgggagctgatgaaagaattgag
caagcttgtgattggggaaacataggaatggttattcgccgtagtgaggatgatggtgtc
acttggggaaaaagagaaactattgtcaatctccgtaataaccctagagttccgctagtt
actagtggtgactatagtggctcacctattaatatggatatggcattagttcaagatact
agctctaagacgaaacgtattttttcaatatatgatatgtttccagaaggaagaggcgtt
attagtattgctaacacacctgaaaaagaatatacccaaatcggaggacagtcttatctt
aatttatataataatggaaagaaatcgaaggtttttactatccgtgacaaaggtattgta
tataattttaaagggaaaaagactgattatcatgttataacagaaactactaaaagtgac
cattcaaatctaggggatatttataagggaaaacagctacttggaaatatatattttaca
aaacataaaacgtcaccatttcgtttagcaaaatcaagctatgtgtggatgtcatatagc
gatgatgatggtaggacatggtcatcacctagagatataacagcaagtcttcgtcagaga
ggcatgaaatttttgggaatagggcctggaaaaggtatagttttaaaatgggggccacac
gctggtcgtattattattcctgcctattctacgaattggaaatctcatctaagaggttca
caatcttcacgcctaatttattcagacgaccatggaaaaacgtggcatactggaaaagca
gtcaatgataaccgtatactttctaatggtgaaaaaattcactccttaacaatggataat
aaaaaagaacaaaatacagaatccgtacccgttcaattgaaaaatggggacattaagtta
tttatgaggaatctaactggtaacctagaagtagccacaagtaaagacggcggggagact
tggcaaaaccatgttaaacgatataaggaaattcatgatgcttacgtccaactatcagct
attcgctttgagcatgacaaaaaagagtatattttattagtgaatgctaatgggccaggg
aagaagcgccaagatggatatgcacgtctagcgcaagttaatcgaaatggtagttttaag
tggttatatcaccatcacattcaagatggttcgtttgcttacaactctgttcaacaactt
aataatgatcaatttggtgtcctttatgaacatagagaaaaacatcaaaatagttttact
ttaaattacaaagtttttaattggagttttcttagtcaaaatacagagaagcaaggcact
ttatgggagaaaatggcagcaaattggcatgttttgtttaaattttatttatga

DBGET integrated database retrieval system