Streptomyces griseoviridis: ELQ87_00655 Help Entry ELQ87_00655       CDS       T06660                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sgd  Streptomyces griseoviridis Pathway sgd00998   Biosynthesis of various antibiotics sgd01100   Metabolic pathways sgd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sgd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ELQ87_00655   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ELQ87_00655 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AZS82970 UniProt:  A0A3Q9KPN8 LinkDB All DBs Position complement(145071..145343) Genome browser AA seq 90 aa AA seqDB search MDDQFTAVLTPFLKFHDDGPLDPETDLRGLGLDSMQAIDLLFAIEDAYGISLPDEAMNDT TFATAGNLWKEVSAALTGQSGSGTPEPGAA NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atggacgatcagttcaccgctgtcctgaccccgttcctgaaattccacgacgacggcccc ctcgaccccgagaccgacctgcgcggcctcggcctcgactcgatgcaggcgatcgacctg ctgttcgccatcgaggacgcctacggcatctccctgccggacgaggcgatgaacgacacc accttcgcgaccgcgggcaacctgtggaaggaagtcagcgccgccctcaccggacagagc ggctccggcaccccggaaccgggtgccgcgtga

DBGET integrated database retrieval system