KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_c10110Help
Entry
SGGBAA2069_c10110 CDS       T01444                                 

Gene name
tdk
Definition
(GenBank) Thymidine kinase
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgg00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SGGBAA2069_c10110 (tdk)
Enzymes [BR:sgg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SGGBAA2069_c10110 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1056648..1057229
Genome map
AA seq 193 aa AA seqDB search
MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRDGYGVVSSRIGMRRKAI
AITEEMDIFAFIQELPEKPYCVLIDECQFLTKKHVYDLARVVDDLDVPVMAFGLKNDFQN
ELFEGSKYLLLLADKIDEIKTICQFCSKKATMVLRTENGKPVYEGNQIQIGGNETYIPVC
RKHYFNPMISKEK
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
ttggctcaactctattataaatatggaaccatgaattctggaaagaccattgaaatttta
aaagttgctcataactatgaagaacaaggcaaacctgtcgtcattatgacttcggcactt
gatacgcgtgatggttatggtgttgtttcaagccgtatcggtatgcgtcgcaaggcgatt
gctattacggaagaaatggacatttttgcttttattcaagaattgccagaaaaaccatac
tgcgttttaattgatgaatgtcaatttttaacgaaaaagcatgtctatgatttggcgcgt
gttgttgatgatttggacgttcctgtgatggcttttgggttaaaaaatgattttcaaaac
gaattgttcgagggctccaaatatctactgttattagcagataaaattgacgagattaaa
accatttgtcagttttgttctaaaaaagcaaccatggtcttgcgaactgaaaatggcaag
cctgtttacgaaggaaatcaaattcaaatcggtggcaacgaaacctatatccccgtttgc
cgtaaacattattttaacccaatgatttccaaagaaaaataa

DBGET integrated database retrieval system