KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_c15370Help
Entry
SGGBAA2069_c15370 CDS       T01444                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sgg00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SGGBAA2069_c15370 (ppc)
  Energy metabolism
   00680 Methane metabolism
    SGGBAA2069_c15370 (ppc)
Enzymes [BR:sgg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SGGBAA2069_c15370 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(1598365..1601190)
Genome map
AA seq 941 aa AA seqDB search
MTIKKLENNSTQSIITEEVKVLKDLLDETTHQMVGDEVFAKIQNIVELSASDEYVKLEKL
VAQLTNDEMVVVSRYFSILPLLINISEDVDFAYEINYQNNTNQDYLGKLSLTVDMVSESE
NSKEILENVNVVPVLTAHPTQVQRKTVLELTNHIHDLLRKYRDVRAGVVNRDKWYTDLRR
YIEIIMQTDIIREKKLKVKNEITNVMEYYNTSLIQAITKLTSEYKRLAAEKGIDLENPKP
ITMGMWIGGDRDGNPYVTAETLRLSATVQSEVIINYYIEKLTGLYRTFSLSTTLTNISPE
VEKLAELSSDKSIYRENEPYRKAFNYIQSKLIQTLIELKAGPAISQRVLESSNNISSDVY
TSTNNASVVTKYLQTKFSKVSSELQEEIPSYKTAKEFKDDLLIIKQSLLDNGDDALLTGD
FSELLQAVDVFGFYLATIDMRQDSSVNEACVAELLKSANIVEDYSALSEEEKVKVLLKEL
QEDPRTLSSTNAEKSEQLQKELAIFQTARYLKDKLGDEVIKQHIISHTESVSDMFELAIM
LKEVGLLDNQKARVQIVPLFETIEDLENSRAIMEEYLDYDIVRRWVSANKGYQEIMLGYS
DSNKDGGYLSSVWTLYKAQNELTRIGSERGIKVTFIHGRGGTVGRGGGPSYEAITSQPFG
SIKDRIRLTEQGEIIENKYGNKDVAYYNLEMLVSATIDRIVTRMITNPDEIDDFRATMDG
IVTYSNGVYRDLVFGNPHFYDYFFEATPIKEVSSLNIGSRPAARKTITEISGLRAIPWVF
SWSQSRIMFPGWYGVGSAFKNFIDAEEGNLAKLQHMYEKWPFFHSLLSNVDMVLSKSNMN
IAFQYAQLAESEEVRDVFNTILDEWQLTKNVILAIEKHEDLLEENPSLQASLDYRLPYFN
VLNYIQIELIKRLRHEELDEDYEKLIHTTINGIATGLRNSG
NT seq 2826 nt NT seq  +upstreamnt  +downstreamnt
gtgacaatcaaaaaactggagaacaatagcacccagtcgattattaccgaggaagtcaaa
gtattaaaagacttgctcgatgagacaactcatcaaatggttggtgatgaggtgtttgcc
aaaattcaaaacattgttgaattgtcagcaagtgatgaatacgtcaaacttgaaaaatta
gtagctcaattaaccaacgatgaaatggttgtagtgtctcgttatttttcaattttgcca
cttttaatcaacatttcagaagacgttgattttgcttatgaaatcaattaccaaaataat
accaatcaagattatcttggtaaactctctttaaccgtagatatggtttcagaaagcgaa
aactctaaagaaatccttgaaaatgtcaatgttgtgcccgtattaacagctcaccctaca
caagttcaacgtaagacagtcctcgaattgacaaatcacattcatgaccttttacgtaaa
taccgcgatgtcagagcgggtgttgtgaaccgtgacaaatggtacactgatttgcgccgt
tacattgaaatcatcatgcaaacggacattattcgtgagaaaaaactgaaggtaaaaaat
gaaattaccaacgttatggagtattacaatacatccttaattcaagcgattaccaagttg
acttcagagtacaaacgcttagcagctgaaaaaggcatcgacctagaaaatccaaaacct
atcacaatgggaatgtggattggtggtgaccgtgacggtaacccatacgtaacagctgaa
acacttcgtttgtcagcaacggttcaaagtgaagtcatcattaactactacattgaaaaa
ttaacaggtctttatcgcacattctcactttcaacaaccttgactaacattagtccagaa
gttgaaaaattagcagaattgtcaagcgataaatctatctaccgtgaaaatgaaccttat
cgtaaggcatttaactatattcaatcaaaattaattcaaaccttaatcgaattaaaagct
ggtccagctatttctcaacgtgttttggaaagtagcaacaacatcagttcagatgtttac
acaagcactaacaacgctagtgtcgttacaaaatacttacaaacaaaattctctaaagtt
tcatcagaacttcaagaagaaattccaagctataaaacagccaaagaatttaaagatgat
ttgcttatcatcaaacaatcattgcttgacaatggtgatgatgcgctcttgacaggtgat
tttagcgaattgcttcaagcagttgatgtctttggattctatcttgcaacgattgatatg
cgtcaagattcaagcgttaacgaagcttgtgttgcagaattgttgaaatcagctaatatc
gttgaggattacagcgcactttcagaagaagaaaaagtaaaagttcttctcaaagaattg
caagaagacccacgtacgttgtcatcaacaaatgctgaaaaatcagaacaacttcaaaaa
gaattagcaatcttccaaacagctcgttaccttaaagataaattaggtgacgaagtcatc
aaacaacacatcatttcacatactgaaagtgtttctgatatgtttgagttagctatcatg
cttaaagaagtcggacttcttgataaccaaaaagcgcgtgttcaaattgtgccactcttt
gaaacaattgaggaccttgaaaattcacgtgctatcatggaagaatatcttgattatgat
attgttcgtcgctgggtttcagctaacaaaggttaccaagaaatcatgcttggttactca
gacagtaacaaagacggtggttacttatcatctgtttggacactttataaagctcaaaat
gaattgactcgtattggttcagaacgtggtattaaagtgacattcattcacggtcgtggt
ggtactgttggtcgtggtggtggtccatcatacgaagctatcacatcacaaccattcggt
tcaatcaaagatcgtattcgtcttactgagcaaggtgaaatcattgaaaataaatacggc
aataaagacgttgcttattacaaccttgaaatgttggtttcagcaactatcgatcgtatc
gtgacacgtatgattacaaatccagatgaaattgatgatttccgtgcaacaatggacggc
attgtcacttactcaaatggtgtttatcgtgatttagtattcggtaatccacatttctat
gattacttcttcgaagcaacaccaatcaaggaagtatcaagcttgaacattggttcacgt
ccagctgcgcgtaaaacaatcacagaaatttcaggtctccgtgcaatcccttgggtattc
tcatggtcacaaagccgtatcatgttcccaggttggtatggtgttggttcagcattcaaa
aactttattgacgctgaagaaggaaacttggcaaaacttcaacatatgtatgaaaaatgg
ccattcttccattcacttctttcaaatgttgatatggtcttgtctaaatcaaatatgaac
attgctttccaatatgctcaattggcagaaagcgaagaagtacgcgatgtctttaatact
atccttgacgaatggcaattgactaaaaatgttattttagcaatcgaaaaacacgaagat
ttgttggaagaaaatccttcgcttcaagcaagcttagactaccgtttgccatacttcaac
gttttgaattacattcaaattgaattgattaaacgtttacgtcatgaagaattggatgag
gattacgaaaaactcattcacacaactatcaacggtattgccacaggattgcgtaattct
ggctga

DBGET integrated database retrieval system