KEGG   Streptomyces griseus: SGR_3413Help
Entry
SGR_3413          CDS       T00691                                 

Definition
(GenBank) putative hydrolase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
sgr  Streptomyces griseus
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    SGR_3413
Enzymes [BR:sgr01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     SGR_3413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Kitasato: 
UniProt: 
LinkDB All DBs
Position
complement(3998972..4000204)
Genome map
AA seq 410 aa AA seqDB search
MSETTTTARDLRERAAVLDAADPLAARRELFALDDGVYLDGNSLGALPVHVPARVQDVLT
RQWGQLRIRSWDESGWWTAPERIGDRIAPLVGAAAGQIVVGDSTSVNVFKAVVAAGRLAG
EGRDEILVDATTFPTDGYIASAAARLTGHRIVPVAPADVPAALGPRTAAVLLNHVDYRSG
RLHDLPGLTAAVHAAGAVVVWDLCHSAGALPVGLDEHRVDLAVGCTYKYLNGGPGSPAYL
YVAERHQAAFDSPLPGWNSHADPFGMTSGYAPADGSVRGRVGTPDIVSMLTLEAALDVWD
GVPVDAVRAKSLALTDFFLECVEAYVPAGRVTSVTPAAHAERGSQVALRCAEAEPVMRRL
IERGVVGDLRRPDVLRFGFTPLYVGFADAERAARILAEVLAEVSAGDTVG
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagaccacgaccacggcgcgggacctccgcgagcgcgccgccgtcctcgacgcc
gccgatccgctcgccgcccgccgcgaactcttcgcgctcgacgacggcgtctacctggac
ggcaactcgctgggcgcgctccccgtccacgtccccgcccgggtgcaggacgtcctcacc
cgccagtggggccaactgcgcatccggtcctgggacgagagcggctggtggaccgcgccc
gagcggatcggcgaccggatcgccccgctggtgggggccgccgcggggcagatcgtcgtg
ggcgactcgaccagcgtgaacgtcttcaaggccgtcgtcgcggcgggccggctcgcgggg
gagggacgcgacgagatcctggttgacgcgacgacctttcccacggacgggtacatcgcg
tccgccgccgcccggctcaccggtcaccggatcgtgcccgtcgcgcccgccgacgtcccg
gccgcgctcgggccgcgtaccgccgccgtgctgctcaaccacgtcgactaccgctccggg
cggctgcacgacctgcccggactgaccgccgccgtccacgcggcgggggcggtcgtggtg
tgggacctctgccacagtgccggcgcgctgcccgtcggactggacgagcaccgcgtggac
ctcgcggtcggctgcacctacaagtacctgaacggcggccccggttcgcccgcgtacctg
tatgtcgccgagcgtcaccaggccgccttcgactcgccgctgccgggctggaactcgcac
gccgacccgttcggcatgacctccggctacgcgcccgcggacgggtccgtacggggccgg
gtcgggacccccgacatcgtctccatgctgacgctggaggcggcgctggacgtgtgggac
ggggtgccggtggacgcggtgcgggccaagtcgctggccctgacggacttcttcctggag
tgcgtcgaggcgtacgtcccggcgggccgggtcacctccgtcaccccggccgcgcacgcc
gaacgcggcagccaggtcgccctgcgctgcgcggaggcggagcccgtgatgcgccggctg
atcgagcggggcgtcgtgggcgatctgcggcgtcccgacgtgctgcggttcggcttcacc
ccgctgtacgtggggttcgccgacgcggaacgggcggcacggatcctcgccgaggtgctc
gccgaggtgtccgccggggacaccgtcggctga

DBGET integrated database retrieval system