KEGG   Streptomyces griseus: SGR_6429Help
Entry
SGR_6429          CDS       T00691                                 

Definition
(GenBank) putative neuramidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
sgr  Streptomyces griseus
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SGR_6429
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SGR_6429
Enzymes [BR:sgr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     SGR_6429
Bacterial toxins [BR:sgr02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   SGR_6429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Kitasato: 
UniProt: 
LinkDB All DBs
Position
7686037..7687476
Genome map
AA seq 479 aa AA seqDB search
MQRRVTVAMLSAALLVATTAGTAHGAPAAAPGELTSQDIATQGVGSPHYRIPALTTSVRG
TLIAAYDTRPTLGDLPGNLGVVVRRSTDGGATWESQQVVRKEAAPKGFGDPSLLVDRTTG
RIFVFYAGSVNQGFFGSGTGNDESDPNILQADYSYSDDDGVTWTHRRITKQIKNPAWAGM
FAASGEGIQVRHGAYEGRLIQQYAIRNNGANYAVSAYSDDHGATWKTGTPVGPGGDENKT
VELSDGRIMLNNRSAPYRTVAYSSDGGVTYTPFVQDTDLPDPANNGSVIRYAPDVPASHP
QASWLLFSNTDSTARKNLTVKMSCDNGRTWPIRKVVDPGSAAYSTLTRLPDGRLGLLYER
ADYRHITYSSFDLKWLGGTCADITITPPATLRAGTTAEVTVRVVNRMDVTRSAGTLDLAV
PAGWSTRQVAFPAVRPGQGANIKVPVTIPAGATGDARLTVTYKADGKQASGSRSVTVTP
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgcagagtcaccgtcgccatgctgtccgccgccctcctggtggccaccaccgcc
ggcaccgcccacggcgcaccggccgccgcccccggtgagctgacctcccaggacatcgcg
acccagggcgtcggctccccccactaccgcatccccgcgctcaccacctccgtccggggc
acgctgatcgccgcctacgacacccgccccacgctcggcgacctccccggcaacctcggc
gtcgtcgtacggcgcagcaccgacggaggcgccacctgggagagccagcaggtcgtccgc
aaggaagcggcccccaagggattcggcgaccccagcctcctcgtcgaccgcacgaccggc
cggatcttcgtcttctacgcgggctccgtgaaccagggcttcttcggctcgggcaccggc
aacgacgagagcgacccgaacatcctccaggccgactacagctactcggacgacgacggc
gtcacctggacccaccgccgcatcacgaagcagatcaagaaccccgcctgggccggtatg
ttcgcggcctccggcgaaggaatccaggtgcgccacggcgcgtacgaggggcggctgatc
cagcagtacgccatccggaacaacggagccaactacgccgtcagcgcctacagcgacgac
cacggagcgacctggaagacgggcaccccggtcggtcccggcggcgacgagaacaagacc
gtcgagctcagcgacggccggatcatgctcaacaaccgctccgcgccctaccggaccgtc
gcgtactccagcgacggcggcgtcacctacacaccgttcgtccaggacaccgacctcccc
gacccggcgaacaacggctcggtcatccgctacgcccccgacgtccccgcctcccacccc
caggcatcctggctgctgttcagcaacaccgacagcaccgcgcgcaagaacctgaccgtg
aagatgtcctgcgacaacggcaggacctggccgatccgcaaggtcgtcgacccgggcagc
gccgcctactcgacgctgacccggctgccggacggccggctcgggctgctctacgagcgc
gccgactaccggcacatcacctactcctccttcgacctgaagtggctcggcggcacctgc
gcggacatcaccatcacgcccccggccacgctgagggccgggaccaccgccgaggtgacc
gtacgcgtcgtcaaccggatggacgtcacgcgcagcgcgggcacgctcgacctggccgta
cccgccggctggagcacgaggcaggtggcgttcccggcggtccggcccggccagggagcg
aacatcaaggtcccggtcacgatcccggcgggcgcgaccggcgacgcccgcctgacggtg
acctacaaggccgacggcaagcaggcctcgggcagccggtcggtgaccgtgaccccgtaa

DBGET integrated database retrieval system