KEGG   Streptomyces griseus: SGR_6690Help
Entry
SGR_6690          CDS       T00691                                 

Definition
(GenBank) putative ATP-dependent DNA ligase
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
sgr  Streptomyces griseus
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    SGR_6690
Enzymes [BR:sgr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SGR_6690
DNA repair and recombination proteins [BR:sgr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     SGR_6690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Kitasato: 
UniProt: 
LinkDB All DBs
Position
7986066..7987028
Genome map
AA seq 320 aa AA seqDB search
MARLPRIAPMLATPGRLPPPSEDTAYAYEVKQDGQRCVVYLPGDGSVQLRSRSGADITPA
YPELAGLGTALGSRPAVLDGEIVAPDEEGRGDFQRLQSRMGLAGSPARAARMAAKTPVHL
MLFDLVFLGTERLTRTPYSERRAVLESLELGGPAWSTPAAVVGHGRQALEMTRAAGFEGL
VAKRRTSLYEPGVRSRAWIKIRHVRTEDVVVGGWLPGHGRLTSLPGALLMGRPAPGGGLR
YVGGVGTGWSDDERTTLGALLHASATDTCPFTERPAVTGARWVEPRLVGEVRYATRTRAG
RLRQPSWHRLRPDLTPDDLR
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcggctgccccgcatcgcaccgatgctcgctacccccggccggctgccgccgccc
tccgaggacaccgcctacgcgtacgaggtgaagcaggacgggcagcggtgcgtggtctac
cttcccggcgacgggtccgtacaactgcgctcccggtccggcgccgacatcacccccgcc
tatcccgagctcgcgggcctgggaacggcgctgggctcccgccccgccgtgctggacggg
gagatcgtcgccccggacgaggaggggcgcggcgacttccagcggctccagtcccggatg
ggactggccggatctccggccagggcggcccgcatggccgcgaagacgcccgtgcacctg
atgctgttcgacctggtgttcctcggcacggaacggctcacccgcaccccgtactccgaa
cgccgcgccgtcctggagtccctggagctgggcgggcccgcgtggtcgaccccggcggcg
gtcgtcggccacgggcggcaggcgctggagatgacacgggccgccggcttcgagggcctc
gtcgccaagcgacgtacctccctctacgagcctggtgtccgctcccgggcgtggatcaag
atccggcacgtacggaccgaggacgtcgtcgtcggcggctggctgcccggccacggccgc
ctcacctcgctgcccggcgccctcctcatgggccgcccggcccccggcgggggactgcgc
tacgtcggcggcgtgggcaccggctggagcgacgacgaacgcaccaccctcggggccctc
ctccacgcctcggcgaccgacacctgcccgttcaccgagcggcccgcggtgaccggcgcc
cggtgggtggagccccggctggtgggagaggtccgctacgcgacccgcaccagggccgga
cggctgcgccagccctcctggcaccgcctgcgccccgacctcacccccgatgacctccgc
tga

DBGET integrated database retrieval system