KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC 43143: SGGB_1510Help
Entry
SGGB_1510         CDS       T02018                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sgt  Streptococcus gallolyticus subsp. gallolyticus ATCC 43143
Pathway
sgt00620  Pyruvate metabolism
sgt00680  Methane metabolism
sgt01100  Metabolic pathways
sgt01120  Microbial metabolism in diverse environments
sgt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sgt00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SGGB_1510 (ppc)
  Energy metabolism
   00680 Methane metabolism
    SGGB_1510 (ppc)
Enzymes [BR:sgt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SGGB_1510 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: BAK28368
UniProt: F5WVR1
LinkDB All DBs
Position
complement(1566584..1569409)
Genome map
AA seq 941 aa AA seqDB search
MTIKKLENNSTQSIITEEVKVLKDLLDETTHQMVGDEVFAKIQNIVELSASDEYVKLEKL
VAQLTNDEMVVVSRYFSILPLLINISEDVDFAYEINYQNNTNQDYLGKLSLTVDMVSESE
NSKEILENVNVVPVLTAHPTQVQRKTVLELTNHIHDLLRKYRDVRAGVVNRDKWYTDLRR
YIEIIMQTDIIREKKLKVKNEITNVMEYYNTSLIQAITKLTSEYKRLAAEKGIDLENPKP
ITMGMWIGGDRDGNPYVTAETLRLSATVQSEVIINYYIEKLTGLYRTFSLSTTLTNISPE
VEKLAELSSDKSIYRENEPYRKAFNYIQSKLIQTLIELKAGPAISQRVLESSNNISSDVY
TSTNNASVVTKYLQTKFSKVSSELQEEIPSYKTAKEFKDDLLIIKQSLLDNGDDALLTGD
FSELLQAVDVFGFYLATIDMRQDSSVNEACVAELLKSANIVEDYSALSEEEKVKVLLKEL
QEDPRTLSSTNAEKSEQLQKELAIFQTARYLKDKLGDEVIKQHIISHTESVSDMFELAIM
LKEVGLLDNQKARVQIVPLFETIEDLENSRAIMEEYLDYDIVRRWVSANKGYQEIMLGYS
DSNKDGGYLSSVWTLYKAQNELTRIGSERGIKVTFIHGRGGTVGRGGGPSYEAITSQPFG
SIKDRIRLTEQGEIIENKYGNKDVAYYNLEMLVSATIDRIVTRMITNPDEIDDFRATMDG
IVTYSNGVYRDLVFGNPHFYDYFFEATPIKEVSSLNIGSRPAARKTITEISGLRAIPWVF
SWSQSRIMFPGWYGVGSAFKNFIDAEEGNLAKLQHMYEKWPFFHSLLSNVDMVLSKSNMN
IAFQYAQLAESEEVRDVFNTILDEWQLTKNVILAIEKHEDLLEENPSLQASLDYRLPYFN
VLNYIQIELIKRLRHEELDEDYEKLIHTTINGIATGLRNSG
NT seq 2826 nt NT seq  +upstreamnt  +downstreamnt
gtgacaatcaaaaaactggagaacaatagcacccagtcgattattaccgaggaagtcaaa
gtattaaaagacttgctcgatgagacaactcatcaaatggttggtgatgaggtgtttgcc
aaaattcaaaacattgttgaattgtcagcaagtgatgaatacgtcaaacttgaaaaatta
gtagctcaattaaccaacgatgaaatggttgtagtgtctcgttatttttcaattttgcca
cttttaatcaacatttcagaagacgttgattttgcttatgaaatcaattaccaaaataat
accaatcaagattatcttggtaaactctctttaaccgtagatatggtttcagaaagcgaa
aactctaaagaaatccttgaaaatgtcaatgttgtgcccgtattaacagctcaccctaca
caagttcaacgtaagacagtcctcgaattgacaaatcacattcatgaccttttacgtaaa
taccgcgatgtcagagcgggtgttgtgaaccgtgacaaatggtacactgatttgcgccgt
tacattgaaatcatcatgcaaacggacattattcgtgagaaaaaactgaaggtaaaaaat
gaaattaccaacgttatggagtattacaatacatccttaattcaagcgattaccaagttg
acttcagagtacaaacgcttagcagctgaaaaaggcatcgacctagaaaatccaaaacct
atcacaatgggaatgtggattggtggtgaccgtgacggtaacccatacgtaacagctgaa
acacttcgtttgtcagcaacggttcaaagtgaagtcatcattaactactacattgaaaaa
ttaacaggtctttatcgcacattctcactttcaacaaccttgactaacattagtccagaa
gttgaaaaattagcagaattgtcaagcgataaatctatctaccgtgaaaatgaaccttat
cgtaaggcatttaactatattcaatcaaaattaattcaaaccttaatcgaattaaaagct
ggtccagctatttctcaacgtgttttggaaagtagcaacaacatcagttcagatgtttac
acaagcactaacaacgctagtgtcgttacaaaatacttacaaacaaaattctctaaagtt
tcatcagaacttcaagaagaaattccaagctataaaacagccaaagaatttaaagatgat
ttgcttatcatcaaacaatcattgcttgacaatggtgatgatgcgctcttgacaggtgat
tttagcgaattgcttcaagcagttgatgtctttggattctatcttgcaacgattgatatg
cgtcaagattcaagcgttaacgaagcttgtgttgcagaattgttgaaatcagctaatatc
gttgaggattacagcgcactttcagaagaagaaaaagtaaaagttcttctcaaagaattg
caagaagacccacgtacgttgtcatcaacaaatgctgaaaaatcagaacaacttcaaaaa
gaattagcaatcttccaaacagctcgttaccttaaagataaattaggtgacgaagtcatc
aaacaacacatcatttcacatactgaaagtgtttctgatatgtttgagttagctatcatg
cttaaagaagtcggacttcttgataaccaaaaagcgcgtgttcaaattgtgccactcttt
gaaacaattgaggaccttgaaaattcacgtgctatcatggaagaatatcttgattatgat
attgttcgtcgctgggtttcagctaacaaaggttaccaagaaatcatgcttggttactca
gacagtaacaaagacggtggttacttatcatctgtttggacactttataaagctcaaaat
gaattgactcgtattggttcagaacgtggtattaaagtgacattcattcacggtcgtggt
ggtactgttggtcgtggtggtggtccatcatacgaagctatcacatcacaaccattcggt
tcaatcaaagatcgtattcgtcttactgagcaaggtgaaatcattgaaaataaatacggc
aataaagacgttgcttattacaaccttgaaatgttggtttcagcaactatcgatcgtatc
gtgacacgtatgattacaaatccagatgaaattgatgatttccgtgcaacaatggacggc
attgtcacttactcaaatggtgtttatcgtgatttagtattcggtaatccacatttctat
gattacttcttcgaagcaacaccaatcaaggaagtatcaagcttgaacattggttcacgt
ccagctgcgcgtaaaacaatcacagaaatttcaggtctccgtgcaatcccttgggtattc
tcatggtcacaaagccgtatcatgttcccaggttggtatggtgttggttcagcattcaaa
aactttattgacgctgaagaaggaaacttggcaaaacttcaacatatgtatgaaaaatgg
ccattcttccattcacttctttcaaatgttgatatggtcttgtctaaatcaaatatgaac
attgctttccaatatgctcaattggcagaaagcgaagaagtacgcgatgtctttaatact
atccttgacgaatggcaattgactaaaaatgttattttagcaatcgaaaaacacgaagat
ttgttggaagaaaatccttcgcttcaagcaagcttagactaccgtttgccatacttcaac
gttttgaattacattcaaattgaattgattaaacgtttacgtcatgaagaattggatgag
gattacgaaaaactcattcacacaactatcaacggtattgccacaggattgcgtaattct
ggctga

DBGET integrated database retrieval system