KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC 43143: SGGB_1646Help
Entry
SGGB_1646         CDS       T02018                                 

Gene name
amyE
Definition
(GenBank) extracellular alpha amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
sgt  Streptococcus gallolyticus subsp. gallolyticus ATCC 43143
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SGGB_1646 (amyE)
Enzymes [BR:sgt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SGGB_1646 (amyE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1712711..1714942)
Genome map
AA seq 743 aa AA seqDB search
MVFRNKEKMKKKLKLGLGSALIFTILGTGTFVQVSVVNADTEQVSMKEGTVLHAWCWSFN
TIKDNMQAIKDAGYTSVQTSPINAVVAGNGGNKSLTNWYYQYQPTVYTIGNYQLGTEEEF
KEMNRVADQYGIKIIVDAVLNHTTSDYNQIDQQIKSIPNWTHGNTQISNWGDRYDVTQSS
LLGLYDWNTQNEYVQQYLLNFLKQAVADGADGFRYDAAKHIELPGEYGSNFWNVILNNGS
EFQYGEILQDSISNEAGYGQLMSITASNYGQQIRYALKDRRVAAGNLANYQVSGVDPANL
VLWVESHDTYANDDQESTWMSDEDIRLGWAMITARAKGTPLFFSRPVGGGNGTRFTGQSQ
IGDAGSDLYKDATVAAVNKFHNAMVGESEYIRNPNGDEQVAMIERGSKGAVIVNLVGGDK
YLDSETNLADGTYTDQVSGRQFNVSNGRITGSVPSRSAVVLYDAKDDETVSASIDGYNEG
NNSISAATEVTLKAKNAQTATYKIDNGQEVAFQDGDKITVGEGLEAGQSTTVTVSATGAD
GQTASKSYTFTMKDPNAETNIYFQNPDNWSDVYVYMYNATNTQLLGAWPGTKMTKDSSGR
YTISVPASYETEGVKVLFTNNSGAQYPQNTGFDFKAEGVYSKDGLVADVPEGMTRISFDN
PGGWDSANLYAYYGNPVQMPLGAWPGQAMTKDAQGNFYIDLPEEYLDLNVKIIFSQPDTS
NQFPASIGFDLVKSGNYNKDGLK
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atggtatttcgtaataaagaaaaaatgaagaaaaagttgaaactgggattaggatctgct
ttgatttttacaatacttggtactggaacatttgttcaagttagtgttgttaatgctgat
acagagcaggtatcgatgaaagaaggaacagtgcttcacgcttggtgctggtctttcaat
actattaaggataatatgcaagcaattaaggatgctggctacactagcgttcagacgtca
ccgattaatgctgttgttgcaggaaatggtggcaataaaagcttgacaaattggtattat
caataccaaccaacggtttatactattggaaattaccaattgggaacagaagaagagttt
aaagaaatgaaccgtgtggctgaccaatacggtatcaaaattattgttgatgctgtgctt
aaccacacaacttctgattacaatcaaattgaccaacaaatcaaaagtattccaaactgg
acgcatggcaatacccaaattagtaattggggagaccgttatgatgtcacacaaagctct
cttttagggctttatgattggaatactcaaaacgaatacgtccaacaatatttgcttaat
ttcttaaaacaagccgttgcggacggtgcagatggtttccgttacgatgctgctaaacat
attgaattaccaggtgaatacggtagtaatttctggaatgttatcttgaataatggttca
gaattccaatatggtgaaattttacaagatagcatttcaaacgaagctggttatggtcaa
ttgatgagtattacagcttcaaattatggtcaacaaattcgttacgctttgaaagatcgc
cgtgttgcagcaggcaatcttgccaattatcaagtgtctggtgttgacccagcaaacctt
gttttgtgggttgaatcacacgatacttacgccaatgatgaccaagaatcaacttggatg
agtgatgaagacattcgtcttggttgggcaatgattacagcgcgtgccaaaggtacccca
ttattcttctcacgtcctgttggcggaggaaatggtacacgctttacaggtcaatcacaa
attggtgatgcaggtagtgacctttataaagatgcaacagtagcagctgttaataaattc
cacaacgctatggttggtgaatcagaatacatccgtaaccctaacggagacgaacaagtt
gctatgattgaacgtggaagcaagggggctgttattgtcaaccttgtcggcggcgacaaa
tatttggattctgaaacaaacttggcagatggtacttacacagaccaagtttcaggacgc
cagtttaatgtttcaaatggacgtatcactggtagcgtaccgtcacgttcagctgttgtg
ttgtatgatgcaaaagacgatgaaacagtttcagcatcaattgatggttacaacgaaggt
aacaattctatttcagcagcaacagaagtgacattgaaagctaaaaatgcgcaaacagca
acttataagattgacaatggtcaagaagttgctttccaagacggtgataaaatcacagtt
ggtgaaggtcttgaagccggtcaatcaacaacggtcacagtcagtgcaactggtgcagat
ggacaaacagcaagcaagagttatacattcaccatgaaagatccgaatgctgaaacaaac
atttacttccaaaatccagataactggtcagatgtttatgtttacatgtataatgccaca
aatacccaacttcttggtgcatggcctggaactaagatgacaaaagattcatcagggcgt
tatacaatttcagttccagcatcatatgagacagaaggtgtcaaagtcctctttacaaac
aatagtggtgcacaatatccacaaaatacaggatttgattttaaagcagaaggtgtttat
tctaaagacggtttagttgcagatgttcctgaaggaatgacacgtatttcatttgataat
cctggtggttgggatagcgcaaatctctatgcttattatggtaatccagtccaaatgcca
cttggtgcgtggcctggtcaagccatgacaaaagatgctcaaggtaatttctatattgat
ctcccagaggaataccttgatttaaacgttaaaatcatctttagccaacctgatactagt
aaccaattcccagctagtatcggctttgatttggtaaaatcaggcaattataacaaagat
ggtttgaaatga

DBGET integrated database retrieval system