KEGG   Streptomyces glaucescens: SGLAU_20510Help
Entry
SGLAU_20510       CDS       T03327                                 

Gene name
glpD2
Definition
(GenBank) Glycerol-3-phosphate dehydrogenase 2
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sgu  Streptomyces glaucescens
Pathway
sgu00564  Glycerophospholipid metabolism
sgu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sgu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SGLAU_20510 (glpD2)
Enzymes [BR:sgu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SGLAU_20510 (glpD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2 3HCDH_N NAD_binding_8 GIDA
Motif
Other DBs
NCBI-ProteinID: AIS00056
UniProt: A0A089Z2J7
LinkDB All DBs
Position
4650928..4652634
Genome map
AA seq 568 aa AA seqDB search
MRTGTLGPAQRAESLASMAERELDVLVVGAGVVGAGTALDAATRGLSTGLVEARDWASGT
SSRSSKLIHGGLRYLEMLDFALVREALKERGLLLERLAPHLVKPVPFLYPLQHKGWERLY
AGSGVALYDAMSMARGHGRGLPLHRHLSRRHALRVAPCLKKDALVGALQYYDAQMDDARF
VATLVRTAVAYGAKAANRARVTGFLREGERVVGARVQDVEGGGEYEIRAKQIVNATGVWT
DDTQAMVGERGRFHVRASKGIHLVVPKDRIHSTTGLILRTEKSVLFVIPWGRHWIVGTTD
TDWDLDKAHPAASSADIDYLLEHVNAVLAVPLTRDDVEGVYAGLRPLLAGESDATSKLSR
EHTVAHPVPGLVVVAGGKYTTYRVMAKDAVDEAVHGLDLRVAECVTEDVPLLGAEGYRAL
WNARARTAQRTGLHVARVEHLLNRYGSLAEEVFELIAADSSLGDPLPGAEDYLRAEIVYA
ASHEGARHLDDVLTRRTRISIETFDRGTRCAHEAAGLMAPVLGWDEDQVDREVQHYEKRV
EAERESQRQPDDLTADAARLGAPDIVPL
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
gtgaggacagggaccctggggccggcgcagcgcgccgagtcactggcatcgatggccgag
cgcgagctggacgtgctggtcgtgggggccggtgtggtcggcgcgggcaccgcgctggac
gccgccacccgcggactgtccaccggcctggtggaggcgcgtgactgggcgtcgggcacg
tcgagccggtccagcaagctgatccacggcggactgcgctacctggagatgctcgacttc
gcgctcgtgcgcgaggcgctgaaggagcgcgggctgctgctggagcggctggccccgcac
ctggtcaaaccggtgccgttcctctaccccctccagcacaagggctgggagcggctctac
gcgggctccggcgtcgcgctctacgacgccatgtcgatggcccgcggccacggccggggg
ctgcccctgcaccggcacctgagccgccgtcacgccctgcgcgtcgccccctgtctgaag
aaggacgccctggtcggtgcgttgcagtactacgacgcacagatggacgacgcccgtttc
gtggccaccttggtgcgcaccgccgtcgcgtacggcgcgaaggccgccaaccgcgcccgg
gtgaccggcttcctgcgcgagggcgaacgggtcgtcggcgcgcgcgtgcaggacgtcgag
ggcggcggggagtacgagatccgcgccaagcagatcgtcaacgccaccggtgtctggacc
gacgacacccaggcgatggtgggggagcgcggccgcttccacgtccgcgcctccaagggc
atccacctcgtcgtgcccaaggaccgcatccactccaccaccgggctcatcctgcgcacc
gagaagtccgtgctcttcgtcatcccctgggggcggcactggatcgtcggcaccaccgac
accgactgggacctggacaaggcccaccccgccgcctccagcgccgacatcgactacctg
ctggagcacgtcaacgcggtcctcgcggtgcccctcacccgcgacgacgtggagggggtc
tacgcgggtctgcgcccgctgctggccggcgagtccgacgccacgagcaagctctcgcgg
gagcacaccgtcgcccacccggtgccggggctggtcgtcgtggcgggcggcaagtacacg
acgtaccgggtcatggccaaggacgcggtcgacgaggccgtgcacggcctggacctgcgg
gtcgccgagtgtgtcaccgaggacgtcccgctgctcggcgccgagggctaccgcgcgctg
tggaacgcgcgggcgcgcacggcccagcgcaccgggctccatgtcgcgcgcgtggagcac
ctgctgaaccggtacggctccctggcggaggaggtgttcgagctcatcgccgccgactcc
tcgctgggcgacccgctgccgggcgccgaggactatctgcgcgccgagatcgtctacgcc
gcctcgcacgagggcgcccgccacctggacgacgtgctgacccggcgcacccggatctcc
atcgagaccttcgaccggggcacccgctgcgcccacgaggccgccgggctgatggcgccg
gtcctgggctgggacgaggaccaggtcgatcgcgaggtgcagcactacgagaagcgcgtg
gaggccgaacgcgagtcgcagcgccagccggacgacctcacggccgacgcggcccggctg
ggcgcgccggacatcgttccgctgtag

DBGET integrated database retrieval system