KEGG   Streptomyces gilvosporeus: B1H19_18220Help
Entry
B1H19_18220       CDS       T05165                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sgv  Streptomyces gilvosporeus
Pathway
sgv00564  Glycerophospholipid metabolism
sgv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sgv00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    B1H19_18220
Enzymes [BR:sgv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     B1H19_18220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: ARF55860
UniProt: A0A1V0TSN8
LinkDB All DBs
Position
complement(4154833..4156539)
Genome map
AA seq 568 aa AA seqDB search
MKTATLGPAQRAEALARMAERELDILVVGGGVVGAGTALDAATRGLATGLVEARDWASGT
SSRSSKLIHGGLRYLEMLDFALVREALKERGLLLQRLAPHLVKPVPFLYPLQHRGWERWY
AGSGVALYDAMSVSSGHGRGLPVHRHLSHKRALRVAPCLKSDVLVGALQYYDAQMDDARY
VATLVRTASAYGAHCANRARVVGFLREGERVVGARVEDVETGGAYAVRARQIVNATGVWT
DDTQALIGERGQFHVRASKGIHLVVPKDRIHSTTGLILRTEKSVLFVIPWGRHWIIGTTD
TDWDLDKAHPAASSADIDYLLEHVNSVLAIPLTRDDVEGVYAGLRPLLAGESDATSKLSR
EHTVAHPVPGLVVVAGGKYTTYRVMAKDAVDEAVHGLDQRVAECVTEDVPLAGAEGYRAL
WNARARIAARTGLHVARIEHLLNRFGALAEEVLELVVADPSLGEPLAAADDYLRAEAVYA
CTHEGARHLDDVLTRRTRISIETFDRGTRSAREVAELMAPALGWDSAQIEKEIAHYEKRV
EAEHESQRQPDDLTADAARLGAPDIVPL
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
gtgaagacagcgacactgggaccggcgcagcgtgccgaggcactcgctcgaatggccgag
cgggagttggacatcctggtcgtcggcggcggggtcgtcggcgcggggacggccctggac
gcggcgacccgaggcctggccaccggactggtcgaggcgcgcgactgggcctcgggcacc
tccagccgctccagcaagctcatccacggcggcctgcgctatctggagatgctggacttc
gccctcgtacgggaggcgctcaaggaacgggggctgctgctccagcggctggcgccccat
ctggtcaagcccgtgccgtttctctacccgttgcagcaccgcggctgggagcgctggtac
gcgggctccggcgtcgccctctatgacgccatgtcggtctcctccggccatggccgcggg
ctgcccgtccaccgccatctctcccacaaacgggcgctgcgcgtggcgccctgcctcaag
agcgatgtgctggtgggcgcgctccagtactacgacgcccagatggacgacgcccgctat
gtggcgacgctcgtgcgcaccgcctccgcgtacggcgcgcactgcgccaaccgggcgcgg
gtggtgggctttctgcgcgagggtgaacgggtggtcggcgcgcgggtggaggacgtcgag
acgggcggcgcctacgccgtccgggcgcggcagatcgtcaacgccaccggggtgtggacc
gatgacacccaggcgctgatcggtgagcgcggacagttccacgtacgcgcctcgaaggga
attcacctggtcgtccccaaggaccggatccactccaccaccgggctcatcctccgtacg
gaaaagagcgtcctgttcgtcatcccctggggacggcactggatcatcgggacgacggac
accgactgggacctcgacaaggcgcatccggcggcctccagcgccgatatcgactatctg
ctggaacacgtcaactccgtgctggccataccgctgaccagggacgacgtggaaggcgtc
tacgccgggctgcggccgctgctggccggcgagtcggatgccaccagcaagctgtcgcgg
gagcacaccgtggcacacccggtgccggggctggtcgtggtggcgggcggcaagtacacg
acgtaccgggtgatggccaaggacgccgtcgacgaggcggtgcacggcctcgaccagagg
gtggcggagtgcgtcacggaggacgtcccgctggcgggcgcggagggctaccgggcgctg
tggaacgcccgcgcccgcatcgcggcccgcaccggcctccatgtcgcccgtatcgagcac
ctcttgaaccgcttcggcgcgctcgccgaggaggtgctggaactggtggtggccgacccc
tcactgggcgaaccgctcgccgccgcggacgactatctgcgcgccgaggccgtctacgcc
tgcacccacgagggcgcccggcatctcgacgacgtcctcacccgccgcacccgcatctcc
atcgagaccttcgaccgcggcacccgcagcgcccgcgaggtcgccgagctgatggccccc
gcgctgggctgggacagcgcccagatcgagaaggagatcgcgcactacgagaagcgggtc
gaggcggagcacgaatcgcagcggcagccggacgatctgacggcggatgcggcgcggctg
ggggcgccggacatcgtgccgctgtga

DBGET integrated database retrieval system