KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_0211Help
Entry
SU5_0211          CDS       T02011                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Pathway
shb00620  Pyruvate metabolism
shb00680  Methane metabolism
shb01100  Metabolic pathways
shb01120  Microbial metabolism in diverse environments
shb01200  Carbon metabolism
Module
shb_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:shb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SU5_0211
  Energy metabolism
   00680 Methane metabolism
    SU5_0211
Enzymes [BR:shb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SU5_0211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AFH43588
LinkDB All DBs
Position
complement(238096..240747)
Genome map
AA seq 883 aa AA seqDB search
MNEQYSALRSNVSMLGKVLGETIKDALGEHILDRVETIRKLSKSSRAGNEANRQELLTTL
QNLSNDELLPVARAFSQFLNLANTAEQYHSISPKGEAASNPEVIARTLRKLKNQPDLNDA
TIKKAVESLSLELVLTAHPTEITRRTLIHKMGEINNCLKQLDNTDIADYERHQVMRRLRQ
LIAQSWHTDEIRKQRPSPVDEAKWGFAVVENSLWQGVPNYLRELNEQLEENLGYKLPVDF
VPVRFTSWMGGDRDGNPNVTADITRHVLLLSRWKATDLFLKDIHVLVSELSMVDATPELL
ALVGEEGASEPYRYLMKKLRARLMATQSWLEARLKGEKLPKPAGLLTQNEQLWEPLYACY
QSLQACGMGIIANGELLDTLRRVKCFGVPLVRIDIRQESTRHTEALGEITRYLGIGDYES
WSEADKQAFLIRELNSKRPLLPRNWEPSNDTREVLETCKVIAEAPKGSIAAYVISMAKTP
SDVLAVHLLLKEAGIGFAMPVAPLFETLDDLNNADDVMTQLLNIDWYRGLIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIELTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEVTVSSLSLYTSAILEANLLPPPEPKDSWRHIMDEL
SVISCETYRGYVRENKDFVPYFRSATPEQELGKLPLGSRPAKRRPTGGVESLRAIPWIFA
WTQNRLMLPAWLGAGTALQKVVEDGKQSELEAMCRDWPFFSTRLGMLEMVFSKADLWLAD
YYDQRLVAKTLWPLGKELRDLLEEDIKVVLAIANDSHLMADLPWIAESIQLRNVYTDPLN
VLQAELLYRSRLTEEQGKSPDPRVEQALMVTIAGVAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcgttgcgtagtaatgtcagtatgctcggcaaggtgctggga
gaaaccatcaaggatgcgctgggagaacacattcttgatcgcgtagaaacaatccgtaag
ctatccaaatcttcacgcgccggcaatgaagctaatcgccaggagctgctcaccacgcta
caaaatttgtctaatgacgagctgctgccagttgcgcgcgcgtttagtcagttcctgaac
ctggccaatactgccgagcaataccacagcatttcgccaaaaggcgaagccgccagcaac
ccggaagtgattgcccgcactctgcgcaaactgaaaaaccaaccggacctcaacgacgca
accatcaaaaaagcggtagagtcgctgtcgctggagttggtgctaaccgcccatccgaca
gaaattacccgccgtacgcttattcacaagatgggtgaaatcaataactgtctgaaacag
cttgataataccgatatcgccgactacgaacgtcaccaggtgatgcgtcgcctgcgccag
ttgattgcccaatcctggcatacggatgagatccgcaagcagcgcccaagcccggtggat
gaagccaaatggggcttcgccgtggttgagaacagcctgtggcagggcgtacctaactat
ctgcgtgaactgaacgaacagctggaagaaaatctcggctacaaattgccggtggatttt
gtgccggtacgttttacctcctggatgggcggcgaccgtgacggcaacccgaacgtgacg
gcggatattacccgccacgtgctcttgttaagccgctggaaagccaccgatctgttcctg
aaagacattcatgttctggtatcagaactgtcgatggtcgacgccacgccggagctgctg
gcgttagtgggcgaagaaggcgcgtctgagccgtatcgctacctgatgaaaaaattgcgc
gcccgtctgatggcgacccagtcctggctggaagcgcgtctgaaaggcgagaagctgccc
aaaccggctggcctgctgacgcaaaacgagcagctctgggaacctctgtacgcctgctac
cagtcgttacaggcctgcggcatgggcattatcgccaacggcgagttacttgacacgctc
cgccgcgtgaagtgtttcggcgtaccgctggtgcgtattgatatccgccaggaaagtacc
cgccatactgaagcgctgggcgaaattacccgctacctcggtattggcgactacgaaagc
tggtcggaagccgacaagcaggccttcctgatccgcgaactgaactccaaacgtccgctg
ctgccgcgtaactgggagccgagcaacgatacccgcgaagtgcttgaaacctgcaaggtt
attgccgaagcgccaaaaggatcgatcgccgcctacgtaatttcaatggcgaaaacgccg
tctgatgtgctggctgtgcatctgctgctgaaagaggcaggtatcggctttgccatgccg
gtcgcgccgctgtttgaaaccctcgacgacctgaacaatgccgacgacgtgatgacccag
ttgttgaatatcgactggtatcgcggactgattcagggtaagcagatggtcatgatcggc
tactccgactcggcgaaagacgccggcgttatggccgcgtcatgggcgcagtatcaggcg
caggacgccctgatcaaaacctgtgaaaaagccggcatcgagctcactctcttccacggc
cgcggcggctctattggccgtggcggcgcgccagcccacgcggcactgctttcgcaaccg
ccaggcagtctgaaaggcggtctgcgcgtgaccgagcagggcgagatgatccgcttcaaa
tacggcctgccggaagtcaccgtcagcagcctttcgctctacaccagcgcaattctggaa
gcaaacctgctgccgccgccggaaccgaaagacagctggcgtcatattatggatgagctt
tccgtcatctcctgtgaaacctaccgcggctacgtgcgcgaaaataaagactttgtaccg
tacttccgctccgcgacgccggagcaagagttgggcaaattgccgctcggctcacgtccg
gcgaaacgtcgtccaactggcggcgtcgaatcgctgcgcgcgattccgtggatcttcgcc
tggacgcaaaaccgcctgatgctgccagcctggctgggcgcgggtactgcgctgcaaaaa
gtggtggaagacggtaaacaaagcgaactggaagccatgtgccgcgactggccgttcttc
tccacgcgtcttgggatgctggaaatggtattctcgaaagccgacctgtggctggccgac
tattacgatcagcgtctggtggcgaaaacgctatggccgctgggcaaagagctacgagac
ctgctggaagaagacattaaagtggtgctggcgattgccaacgattcgcacctgatggcc
gacttaccgtggattgcggagtccattcagttaagaaacgtttataccgatccattaaac
gtgttgcaggccgagttgctgtatcgttcccgtctgactgaagagcagggcaaatcgccc
gatcctcgcgtcgaacaggcgttgatggtcacgattgcgggcgtcgccgccggtatgcgc
aacaccggctaa

DBGET integrated database retrieval system