KEGG   Shewanella sp. MR-4: Shewmr4_2129Help
Entry
Shewmr4_2129      CDS       T00388                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
she  Shewanella sp. MR-4
Pathway
she00473  D-Alanine metabolism
she00550  Peptidoglycan biosynthesis
she01100  Metabolic pathways
she01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:she00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Shewmr4_2129
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Shewmr4_2129
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Shewmr4_2129
Enzymes [BR:she01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Shewmr4_2129
Peptidoglycan biosynthesis and degradation proteins [BR:she01011]
 Precursor biosynthesis
  Amino acid ligase
   Shewmr4_2129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp RimK CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ABI39202
JGI: Shewmr42129
UniProt: Q0HIB5
LinkDB All DBs
Position
2541753..2542763
Genome map
AA seq 336 aa AA seqDB search
MSKINLLLLCGGGSAEHDISLLSANYFETSLAKSEQFNVLRVVLDKFGQYQTAAGDDCEL
TNNREIRFRDETKAPWPVDYVIPCIHGYPGETGDIQSYFNLIQLPYFGCESEASSNCFNK
ITAKMWFSALGIPNTPYIFLNQYDDEAIAQTQAALENWGSIFVKAASQGSSVGCYKVDDS
SKVAGVLKDAFGYAPYVIVEKTIKARELEVAVYEYQGEVVATLPGEIICDSNTFYTFDEK
YAKSSKARTDVVAQNVPTDISEQIRAYAIKAFKGMKLRHLSRIDFFLTQDNEILLNEINT
FPGSTPISMFPKMLQNHGHDFTEYLSLVINGQLAAK
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaatcaatttacttttgctgtgcggcggtggaagtgcggaacacgatatttcc
ctactgtcggctaattattttgaaacctcattagcaaaatccgagcagtttaatgtactg
cgtgtggtactggacaagtttggccaataccaaaccgccgcaggcgatgactgtgagctg
accaataaccgcgaaattcgcttccgtgatgagaccaaggcgccttggcctgtggattat
gtgatcccctgtattcacggctatccgggcgagacaggcgacatccagtcgtactttaac
cttatccaactgccctactttggttgcgaatccgaagccagcagcaactgttttaacaag
atcaccgctaagatgtggttcagtgccttaggcattcctaacacaccttatatcttctta
aatcaatacgatgatgaagcgattgcccaaacccaagccgcgctcgaaaactggggttcg
attttcgtcaaagccgcatctcaaggttcttctgtgggttgctataaagtcgatgacagc
agcaaagtcgcaggcgtgttaaaagatgcctttggttatgcaccctatgtgattgtcgaa
aaaaccattaaagcccgtgagcttgaagtcgccgtttatgagtatcaaggcgaagtggtt
gcgactctgccgggcgaaatcatctgcgatagcaataccttctacaccttcgatgaaaaa
tacgccaagagcagtaaggcacgcaccgatgtagtcgcacaaaatgtgcctactgacatc
agcgagcagatccgcgcctatgcaattaaagcctttaagggcatgaagcttcgccatctg
tcacgtatcgactttttcttaacccaggataatgaaatcctgcttaacgaaatcaatacc
ttcccaggttcgacgccgatttcgatgttccctaagatgttacaaaaccatgggcatgat
tttaccgaatacttaagtttggtgattaacggccagttagcggctaagtga

DBGET integrated database retrieval system