KEGG   Shewanella sp. MR-4: Shewmr4_3183Help
Entry
Shewmr4_3183      CDS       T00388                                 

Definition
(GenBank) Glutathione S-transferase, N-terminal domain protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
she  Shewanella sp. MR-4
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:she00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Shewmr4_3183
Enzymes [BR:she01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Shewmr4_3183
Transporters [BR:she02000]
 Other Transporters
  Pores ion channels [TC:1]
   Shewmr4_3183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
LinkDB All DBs
Position
complement(3802648..3803277)
Genome map
AA seq 209 aa AA seqDB search
MITLYGTPRSRALRVSWVLEELGAEWAFSFVDMNKGEHRSAAFLALNPCGKVPVLTDDNL
VLSESAAICLYLAEKFGQLLPAPGTTASGLHHQWVSFIITELEQPLWTMGKHKFALPEAQ
RHPSIMPCAVWEFDKAAALAEAMLPDSDFLLGDTLSVADILLAHTLIWGTLFEQQIPPKL
AAYRDRVAARPSRKSALAKMEAVANAAQA
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccttatatggcacaccacgcagccgagcattacgagtctcttgggtgttagaa
gagttaggcgccgaatgggccttttcgtttgtggatatgaataagggcgagcaccgtagc
gccgctttcttagcgctcaatccctgcggcaaagtgccagtgttaaccgatgataatcta
gttttatctgagtcggcggccatttgcctgtatctggcggagaaatttggccagttgtta
cctgcgccgggcactactgcatcgggtctgcatcatcaatgggttagctttattatcacc
gaactcgagcagccactgtggacaatgggcaaacataaatttgccctcccggaagcgcag
cgtcatccttctattatgccctgcgctgtgtgggagtttgataaggcggcggccttggcc
gaagctatgctgcccgatagtgactttttactcggcgacaccttgtcggttgccgatatc
ctgcttgcccacaccctcatttggggcactttatttgagcagcagatcccgcctaaattg
gcggcgtatcgagatagagtagcggcgcgtccttcgcgtaaatcggcactcgctaaaatg
gaagccgtcgccaacgcagcgcaggcttaa

DBGET integrated database retrieval system