KEGG   Shewanella sp. FDAARGOS_354: CEQ32_05285Help
Entry
CEQ32_05285       CDS       T04944                                 

Definition
(GenBank) peptidyl-dipeptidase
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
shf  Shewanella sp. FDAARGOS_354
Brite
Enzymes [BR:shf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     CEQ32_05285
Peptidases [BR:shf01002]
 Metallo Peptidases
  Family M2
   CEQ32_05285
Exosome [BR:shf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CEQ32_05285
CD molecules [BR:shf04090]
 Proteins
  CEQ32_05285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1161990..1163840
Genome map
AA seq 616 aa AA seqDB search
MTIRLNHPTTLALTIALTLGLSACNDAQSKADATTANKNAPDKAQAIAFIQDAEAQMAQL
SIEANRAEWIYSNFITEDTAALSVAVGEKVSAASVKFATEAAKYANVELDPANARKLNIL
RSALVLPAPLDPAKNAELAQISSELNGLYGKGKYCFADGKCMTQPELSTLMAESRDPAKL
LEAWKGWREIAKPMRPLFQREVELANEGAKDLGYANLSELWRSQYDMKPDEFSQELDRLW
GQVKPLYESLHCYVRGELNNEYGDAIAPKTGPIPAHLLGNMWAQQWGNVYDLVAPNDADP
GYDVTELLEQKSYDEQKMVKQAESFFTSLGFAPLPESFWSRSLFLQPKDRDVVCHASAWD
LDNLDDIRIKMCIQKTAEDFTVIHHELGHNFYQRAYKQQPFLFKNSANDGFHEAIGDTIA
LSITPSYLKQIGLLEDVPDASKDIGLLLKQALDKIAFLPFGLMIDQWRWKVFSGEITPAQ
YNQAWWELREKYQGVKAPTDRSEADFDPGAKYHVPGNVPYTRYFLAHILQFQFHKALCET
AGDKGPVHRCSIYGNQAAGEKLNKMLALGASQPWPVALKEVTGTEMMDASAVLDYFAPLK
IWLDEQNKAANRQCGW
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgactattcgattaaatcatcccacgacactcgcgctcaccattgcgctaaccttaggc
ttaagcgcctgtaatgatgcacaaagcaaggccgatgctactacagctaacaaaaatgcg
cccgataaagcccaggccattgcctttatacaagatgcggaagcgcaaatggcgcagtta
tccatcgaagcgaatcgtgccgaatggatttacagcaactttattaccgaagataccgca
gcattatcggtcgccgtgggtgaaaaagtcagcgccgcttccgttaagtttgccactgaa
gccgcaaagtatgccaatgtggaactcgatcccgccaatgcgcgcaaactgaatattctg
cgcagtgcacttgtgttaccggcgccgctggatcccgccaaaaatgctgagctcgcgcaa
atcagctccgagctcaatgggctctacggtaaaggcaaatattgcttcgccgatggcaaa
tgtatgacgcaacctgaactgtctaccctgatggcggaatcgcgggatcccgctaaatta
cttgaagcgtggaaaggctggcgtgaaattgccaaaccaatgcgcccgctatttcaacgt
gaagttgaactcgctaacgaaggcgcaaaagacttaggctacgcgaatctgtccgagttg
tggcgcagccaatacgatatgaaacccgatgaattttcacaggaattagaccgtttatgg
ggacaagttaaacccctctacgaatccctgcattgttatgttcgcggcgagctgaataac
gaatacggtgatgccattgcgccgaaaacaggcccgattccggcacatttgctaggaaat
atgtgggcgcagcaatgggggaatgtgtacgatctcgtcgccccgaatgatgcagatcca
ggctatgatgtgacggaattgcttgagcagaaaagctacgatgaacagaagatggtgaaa
caagccgaaagctttttcacctctttgggctttgcgccgctgccagaaagtttctggagc
cgctctttattcttacaacccaaagaccgtgatgtcgtttgtcacgcctcggcatgggat
ctggataacctcgatgatatccgcatcaagatgtgtatccagaaaaccgctgaagacttc
accgtcattcaccacgaacttggacacaacttctatcaacgtgcctataaacagcagcct
ttcctatttaaaaacagtgccaatgatggtttccatgaggccattggtgacacgattgcg
ctatctatcaccccaagctatctaaaacagattggtttgctcgaagacgtacccgatgct
tcgaaggatattggcttactgcttaaacaagctctggataaaatcgcctttctccccttt
ggtttgatgatcgaccaatggcgttggaaggtatttagtggcgaaattacccctgcgcaa
tataaccaagcctggtgggaattaagagagaaataccaaggcgttaaggccccgactgac
cgcagcgaagccgattttgacccaggtgcaaaataccatgtgcccggtaatgtgccttat
acccgctattttctcgcgcatattctgcaattccagttccacaaggcgctgtgtgaaacg
gctggagacaagggccctgtgcatcgatgcagtatttacggcaatcaagcggcaggagaa
aaactcaataaaatgttagcgcttggtgcaagccaaccttggcccgttgccttaaaagaa
gtcacaggaacggaaatgatggatgcgagcgccgtactcgattattttgcgccgcttaaa
atctggcttgatgagcagaacaaagctgcgaatcgtcaatgtggctggtaa

DBGET integrated database retrieval system