KEGG   Sphingobacterium sp. 21: Sph21_2161Help
Entry
Sph21_2161        CDS       T01450                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
shg  Sphingobacterium sp. 21
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:shg00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Sph21_2161
Enzymes [BR:shg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Sph21_2161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2651549..2652793
Genome map
AA seq 414 aa AA seqDB search
MERIIAKYYIETPFDPEKAALTLAGEQSSGTFVSVPGETEDLKRRFAARVESVHLLGSVS
QPAIPSPKFTSERYQRAYIEISWSIENFGYNLPVLISTLQGNLYELSQFTGLKLLDIQFP
ASYIAHFEGPRFGVAGSRASTKVDGRPLIGTIIKPSIGMSPSDSARLVKTLVEAGIDFIK
DDELQSAAANSKLEDRVDAIMRVINAHADKTGKKVMYAFNISDELDSMLSRYDYIVKAGG
TCAMLSINSVGLAGVKKICDQGALVIHGHRNGWGMLNRHPLLGIEFTAYQKLWRLAGVDQ
LHVNGIQNKFWESDDSVVQSIEACLTPLFSRETLLPVVSSGQWGGQAFETYRRTKTIDLL
YMAGGGIMAHPKGPGGGVVALQQAWEGAVKGLVMEEAVRLYPEFAQSVQKFGQQ
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaattattgcgaaatactatattgaaactccctttgatccggaaaaagcggct
ttgaccttggcgggcgaacaatcatcgggtacctttgtgtcagttcccggtgaaacggaa
gatctaaagcgacgctttgctgcgcgtgtggaaagtgttcacctgctgggatcggtttca
cagccggccattccgagcccgaagttcacatccgaacggtatcaacgagcttatatcgaa
atctcctggtcgatagaaaattttggctataatttaccggtgcttatttccactttgcaa
gggaatctctatgagctcagtcagttcacgggtttgaaactattggatattcaattcccg
gcatcctatatcgctcattttgaagggcctcgttttggagtggccggttcccgagcaagt
acaaaggtggacggacgacccttgatcggcaccattattaaaccgagtattggcatgagc
ccttcggatagtgctagattggtgaaaaccttggtggaggccggtattgactttataaaa
gatgacgaactgcaatcagcagcagctaactccaagttggaagatcgggttgacgccatt
atgcgtgtcatcaatgcgcatgcggacaaaaccgggaaaaaggtcatgtatgcttttaac
attagcgatgaattggatagcatgttgtctcgttatgactatatcgttaaggcaggcggt
acctgcgccatgctcagtatcaatagtgttggccttgctggcgtaaaaaaaatatgtgat
cagggtgcattggttatccacggtcatcggaatggttggggtatgctgaataggcacccc
ctgctgggtattgaatttacggcctaccaaaaactttggcgcttggcaggcgtagatcag
ctacatgtaaatggaattcagaataaattctgggaatcggatgattcggtggtacagtcc
atcgaagcttgcttaacgcctttattttctcgtgaaacattattgcccgtggtatcttcc
ggccagtggggagggcaagcctttgaaacctacaggcgtacgaaaaccattgatttattg
tacatggcaggaggcgggattatggcgcatcccaaaggtcccggtgggggtgtggtggcc
ttgcaacaggcttgggagggcgcggttaaaggacttgtcatggaagaggccgttcgacta
tatcctgaatttgcccaatcggttcaaaaatttggtcagcaataa

DBGET integrated database retrieval system