KEGG   Staphylococcus haemolyticus Sh29/312/L2: ShL2_00807Help
Entry
ShL2_00807        CDS       T03837                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
shh  Staphylococcus haemolyticus Sh29/312/L2
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shh00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ShL2_00807 (tdk)
Enzymes [BR:shh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     ShL2_00807 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
845275..845874
Genome map
AA seq 199 aa AA seqDB search
MYETYHSGWIECITGSMFSGKSEELIRRLRRGIYAKQKVVVFKPAIDDRYHKEKVVSHDG
NELEAINISTSRDILLQDLSHVDVIGIDEIQFFDKEIVNIVEKLAENGHRVVVAGLDMDF
RGEPFEPMPQIMAVSEQVTKLQAVCAVCGSSSSRTQRLIDGQPAKVDDPIILVGANESYE
PRCRAHHIVAPSTSDEEEM
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaaacttaccattccggttggattgaatgcattactggaagtatgtttagcggt
aagtcagaagaactaattcgtagactaagaagagggatatacgctaaacaaaaagtagta
gtgtttaaaccagcgattgatgatcgttatcataaagaaaaagttgtttctcatgacggt
aatgaattagaagcaattaatatttctacttcaagagatatattattacaggatttgtct
catgttgatgtcattggtattgatgagattcaatttttcgataaagaaattgtaaatata
gtggagaagcttgctgaaaatggccatcgagtagtggttgcaggcttagatatggatttc
agaggggaaccattcgaacccatgccacaaatcatggcggtaagtgaacaagttactaaa
ttacaggctgtatgtgcagtatgtggttcatcatcaagtagaacacaacgcttaatcgat
ggacagccagctaaagtagatgatcctatcattttagttggggcgaatgaaagttatgaa
ccgagatgtcgtgcacatcatatcgtagcaccaagtacaagtgacgaggaggaaatgtag

DBGET integrated database retrieval system