KEGG   Shewanella sp. MR-7: Shewmr7_0180Help
Entry
Shewmr7_0180      CDS       T00389                                 

Definition
(GenBank) translation elongation factor 1A (EF-1A/EF-Tu)
  KO
K02358  
elongation factor Tu
Organism
shm  Shewanella sp. MR-7
Brite
Translation factors [BR:shm03012]
 Eukaryotic Type
  Elongation factors
   Shewmr7_0180
 Prokaryotic Type
   Shewmr7_0180
Mitochondrial biogenesis [BR:shm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Shewmr7_0180
Exosome [BR:shm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Shewmr7_0180
  Exosomal proteins of breast cancer cells
   Shewmr7_0180
  Exosomal proteins of colorectal cancer cells
   Shewmr7_0180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
206737..207921
Genome map
AA seq 394 aa AA seqDB search
MAKAKFERNKPHVNVGTIGHVDHGKTTLTAAISHVLAKTYGGEAKDFSQIDNAPEERERG
ITINTSHIEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVASTDGPMPQTREHI
LLSRQVGVPFIIVFMNKCDMVDDAELLELVEMEVRELLSEYDFPGDDLPVIQGSALKALE
GEPEWEAKIIELAEALDSYIPEPERDIDKPFLMPIEDVFSISGRGTVVTGRVERGIVRVG
DEVEIVGIRATTKTTCTGVEMFRKLLDEGRAGENCGILLRGTKRDDVERGQVLSKPGSIN
PHTTFESEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMK
VTLICPIAMDEGLRFAIREGGRTVGAGVVAKIFA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagctaaatttgaacgtaataagccccatgttaacgtgggcaccatcggtcac
gttgaccatggtaaaaccactctgactgcagctatctctcacgtactggctaagacctac
ggtggtgaagctaaagacttctctcaaatcgataacgctccagaagagcgtgagcgcggt
attaccatcaatacctctcacatcgaatacgatactccaactcgccactacgcacacgta
gactgcccaggccacgctgactatgttaaaaacatgatcactggtgctgcacagatggac
ggcgcgatcctggtagtagcttctactgacggtccaatgccacaaactcgtgagcacatc
ctgctgtctcgccaagtaggcgtacctttcatcatcgtattcatgaacaagtgtgacatg
gttgacgatgctgaactgttagaattagtagaaatggaagtacgtgaactgttatcagaa
tacgacttcccaggtgatgacttaccagttatccaaggttctgctctgaaagcgctagaa
ggcgagccagagtgggaagctaagatcatcgaattagcagaagcactggattcttacatt
ccagaaccagagcgtgatatcgataagccattcctgatgccaatcgaagacgtattctca
atctctggccgtggtacagtagtaactggtcgtgttgagcgtggtatcgtacgtgtaggt
gacgaagtagaaatcgttggtatccgtgcaaccactaagacaacctgtactggtgttgaa
atgttccgtaagctgcttgacgaaggtcgtgcaggtgagaactgtggtatcctgttacgt
ggtactaagcgtgatgacgtagaacgtggtcaagtattatctaagccaggttcaatcaac
ccacacactacttttgaatcagaagtttacgttctgtcaaaagaagaaggtggtcgtcac
actccattcttcaaaggctaccgtccacagttctacttccgtacaactgacgtgactgga
actattgaactgccagaaggcgtagagatggtaatgccaggcgataacatcaagatgaaa
gttaccctgatctgcccaatcgcgatggacgaaggtttacgcttcgcaatccgtgaaggt
ggccgtacagtaggtgctggtgttgtagctaagattttcgcttaa

DBGET integrated database retrieval system