KEGG   Shewanella sp. MR-7: Shewmr7_1924Help
Entry
Shewmr7_1924      CDS       T00389                                 

Definition
(GenBank) Peptidyl-dipeptidase A
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
shm  Shewanella sp. MR-7
Brite
Enzymes [BR:shm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     Shewmr7_1924
Peptidases [BR:shm01002]
 Metallo Peptidases
  Family M2
   Shewmr7_1924
Exosome [BR:shm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Shewmr7_1924
CD molecules [BR:shm04090]
 Proteins
  Shewmr7_1924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(2271601..2273463)
Genome map
AA seq 620 aa AA seqDB search
MAILLNRPTTLALTIALTLGLTACNDAQSKAEATTAAPAATKTAPDKAQAIAFIQDAETH
MAQLSIEANRAEWIYSNFITEDTAALSASVGEKVSAASVKFATEAAKYANVELDPANARK
LNILRSALVLPAPLDPAKNAELAQISSELNGLYGKGKYCFADGKCMTQPELSSLMAESRD
PAKLLEAWKGWREIAKPMRPLFQREVELANEGAKDLGYANLSELWRSQYDMKPDEFSQEL
DRLWGQVMPLYESLHCYVRGELNNEYGDAIAPKTGPIPAHLLGNMWAQQWGNVYDLVAPD
DADPGYDVTELLEQKGYDEHKMVKQAESFFTSLGFAPLPDSFWSRSLFLQPKDRDVVCHA
SAWDLDNLDDIRIKMCIQKTAEDFTVIHHELGHNFYQRAYKQQPFLFKNSANDGFHEAIG
DTIALSITPSYLKQIGLLEDVPDASKDIGLLLKQALDKIAFLPFGLMIDQWRWKVFSGEI
TPAQYNQAWWELREKYQGVKAPTDRTEADFDPGAKYHVPGNVPYTRYFLAHILQFQFHKA
LCDTAGDKGPVHRCSIYGNQAAGEKLNKMLELGASQPWPVALKEVTGTEGMDAKAVLDYF
APLKTWLDEQNTAANRQCGW
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atggctattctattgaatcgtcccaccactctcgcgctcaccatagcactaaccttaggc
ttaaccgcctgtaatgatgcccaaagcaaagcagaggccacaaccgctgcacctgctgca
actaaaaccgcgcccgataaagctcaggccatcgcctttattcaagatgcggaaacccac
atggcgcagctttctatcgaagcgaatcgcgccgaatggatttacagtaactttatcacc
gaagatactgcagccttatctgcctctgtgggtgaaaaagtcagtgccgcgtcggtcaaa
ttcgctaccgaagctgccaaatacgccaatgtagaactcgatcccgccaatgcgcgcaaa
ctgaatattctgcgcagcgcactcgtgttacctgcgccactggatcccgccaaaaatgct
gagctggcgcaaatcagctccgagctcaatggactgtatggtaaaggcaaatactgtttc
gccgatggcaagtgtatgacccagccagagctatcgagcctgatggccgaatcgcgtgac
ccagccaaactgcttgaggcatggaaaggttggcgtgaaattgcaaaaccgatgcgccct
ctttttcaacgtgaagttgaactcgccaacgaaggtgcaaaagacctaggttacgctaac
ctctctgagttatggcgcagccaatacgatatgaaacccgatgagttttcacaggaatta
gaccgtttatggggacaagttatgcctctctacgaatccctgcattgttatgttcgcggc
gagctgaataacgaatacggtgacgccattgcgccaaaaaccggccctattcccgcacac
ttactgggaaatatgtgggcacaacaatggggtaatgtgtacgatctcgtcgcccctgac
gatgccgatcctggctatgatgtgacggaattgctcgagcagaaaggctatgatgagcac
aaaatggttaaacaggccgaaagctttttcacctcgttaggctttgcgccactgccagac
agtttttggagtcgctctttattcttgcaacccaaggatcgtgatgtcgtttgtcatgcc
tcggcgtgggatttggataacctcgacgatattcgcatcaagatgtgtatccagaaaacc
gctgaagacttcaccgttattcaccacgaacttgggcacaacttctatcaacgtgcctat
aaacagcagcctttcctgtttaaaaacagtgccaatgatggtttccatgaggccattggt
gacacgatcgcgctatcaattaccccaagctatctaaaacagattggcttgctcgaagac
gtgcccgatgcttccaaggatattggcttactgctgaaacaagctctggataaaatcgcc
ttcctaccctttggtttgatgattgaccagtggcgctggaaagtctttagcggtgaaatc
actccagcgcagtataaccaagcctggtgggaattaagagagaaataccaaggcgttaag
gcgccgacagaccgcactgaagccgattttgacccaggtgccaagtaccatgtgcccggt
aacgtgccttatacgcgctacttcctcgcgcatatcctgcaattccagttccataaggca
ctgtgtgataccgccggcgataaaggacctgtacatagatgcagtatttatggcaatcaa
gccgcaggggaaaaactcaataaaatgttagagctgggtgcaagccaaccttggccagtt
gctttaaaagaagtgacaggtactgagggaatggatgccaaagccgtactcgattatttt
gcgccgcttaaaacctggctcgatgagcaaaacacggcggcgaatcgccaatgtggttgg
taa

DBGET integrated database retrieval system