KEGG   Shewanella sp. ANA-3: Shewana3_2156Help
Entry
Shewana3_2156     CDS       T00428                                 

Definition
(GenBank) peptidase M2, peptidyl-dipeptidase A
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
shn  Shewanella sp. ANA-3
Brite
Enzymes [BR:shn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     Shewana3_2156
Peptidases [BR:shn01002]
 Metallo Peptidases
  Family M2
   Shewana3_2156
Exosome [BR:shn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Shewana3_2156
CD molecules [BR:shn04090]
 Proteins
  Shewana3_2156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: ABK48386
JGI: Shewana32156
UniProt: A0KX67
LinkDB All DBs
Position
2584055..2585914
Genome map
AA seq 619 aa AA seqDB search
MAILLNRPTTLALTIALTLGVTACNDAQSKAETTAAPAATNAAPDKAQAIAFIQDAEAQM
AQLSIEANRAEWIYSNFITEDTAALSAAVGEKVSAASVKFATEAAKYANVELDPANARKL
NILRSALVLPAPLDPAKNAELAQISSELNGLYGKGKYCFADGKCMTQPELSSLMAESRDP
AKLLEAWKGWREIAKPMRPLFQREVELANEGAKDLGYANLSELWRSQYDMKPDEFSQELD
RLWGQVKPLYESLHCYVRGELNNEYGDAIAPKTGPIPAHLLGNMWAQQWGNVYDLVAPDD
ADPGYDVTELLEQKGYDEHKMVKQAESFFTSLGFAPLPDSFWSRSLFLQPKDRDVVCHAS
AWDLDNLDDIRIKMCIQKTAEDFTVIHHELGHNFYQRAYKQQPFLFKNSANDGFHEAIGD
TIALSITPSYLKQIGLLEDVPDASKDIGLLLKQALDKIAFLPFGLMIDQWRWKVFSGEIT
PAQYNQAWWELREKYQGVKAPTDRSEADFDPGAKYHVPGNVPYTRYFLAHILQFQFHKAL
CDTAGDKGPVHRCSIYGNQAAGEKLNKMLELGASQPWPVALKEVTGTKGMDAKAVLDYFA
PLKTWLDEQNTAANRQCGW
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atggctattctattgaatcgtcccaccactcttgcgctcaccatagcactaaccttaggc
gtaaccgcctgtaatgatgcccaaagcaaggccgaaaccactgcagcacctgctgcaact
aatgctgcgcccgataaagctcaggccatcgcctttattcaagatgctgaagcccagatg
gcgcagctctctatcgaagcgaatcgcgccgaatggatttacagtaacttcatcaccgaa
gataccgctgcactttcggccgcagtcggtgaaaaagtcagtgccgcgtcggtaaaattt
gccaccgaagctgccaagtacgccaatgtggaactcgatccagccaatgcgcgcaaactg
aatattctgcgcagcgcactcgtgttacctgcgccgcttgatcccgccaaaaatgctgag
ctggcgcaaatcagctccgagctcaatggactctatggtaaaggcaaatactgtttcgcc
gatggcaagtgtatgacccagccagagctgtcgagcctgatggcggaatcgcgtgaccca
gccaaactgcttgaggcatggaaaggttggcgcgaaattgcaaaaccgatgcgcccacta
tttcaacgtgaagttgaactcgccaacgaaggtgcaaaagatctaggttacgctaacctc
tctgagttatggcgcagccaatacgatatgaaacccgatgaattttcacaggagttagat
cgtttatggggacaagttaagcccctctatgaatccctgcattgttacgttcgcggcgag
ctgaataacgaatacggtgatgccatcgcgccaaaaaccggccctattcccgcacactta
ctgggaaatatgtgggcgcagcaatggggcaatgtgtacgatctcgtcgcccctgacgat
gccgatcctggctatgatgtgacggaattgctcgagcagaagggctatgatgaacacaag
atggttaaacaggccgaaagctttttcacctcgttaggctttgcgccgctgccagacagt
ttctggagtcgctctttattcttgcaacccaaggatcgtgatgtcgtttgtcatgcctcg
gcgtgggatttggataacctcgacgatattcgcatcaagatgtgtatccagaaaaccgct
gaagactttaccgttattcaccacgagcttggacacaacttctatcaacgtgcctataaa
cagcagcctttcctgtttaaaaacagtgccaatgatggtttccatgaggccattggtgac
acgatcgcgctatctattaccccaagctatctaaaacagattggcttgctcgaagatgtg
cccgatgcttctaaggatattggcttactgctgaaacaagctttagataaaatcgccttc
ctgccctttggtttgatgattgaccagtggcgctggaaagtctttagcggtgaaatcact
ccagcgcagtataaccaagcctggtgggaattaagagagaaataccaaggcgttaaggcg
ccaacggatcgcagcgaagccgattttgacccaggtgccaaataccatgtgcccggtaac
gtgccttatacgcgctacttcctcgcacatattctgcaattccagttccataaggcgcta
tgtgataccgccggcgataaaggacctgtacacagatgcagtatttatggcaatcaagcc
gctggggaaaaactcaataaaatgttagagctgggtgcaagccaaccttggccagttgct
ttaaaagaagtgacaggtactaagggaatggatgccaaagccgtactcgattattttgcg
ccgcttaaaacttggctcgatgagcaaaacacggcggcgaatcgtcaatgtggttggtaa

DBGET integrated database retrieval system