KEGG   Shewanella sp. ANA-3: Shewana3_2866Help
Entry
Shewana3_2866     CDS       T00428                                 

Definition
(GenBank) Glutathione S-transferase, N-terminal domain protein
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
shn  Shewanella sp. ANA-3
Brite
Enzymes [BR:shn01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     Shewana3_2866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
3425724..3426392
Genome map
AA seq 222 aa AA seqDB search
MIDLYTAATPNGFKISIALEEMGLDYRVHKLDFNTNEQKQPEFLAINPNGRIPAIIDRDN
EDFVVFESGAILLYLAEKTGKFLPADPKKRSQVIQWLMFQMSGVGPMMGQANVFYRYFPE
KIPAAIERYQKEGRRLFEVMNTQLAKHQYLAGDEYTIADIATWPWVRIHEWSGINMQGLT
HLQRWLDELALRPACQKGIVTPPPSVLSDEERAKQIQKMVTK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgattgatttatataccgccgcgaccccgaacggttttaaaatttccatcgcgctcgaa
gaaatgggtctcgactaccgagtgcataagctagatttcaacactaacgaacagaaacag
cctgagtttctcgccattaaccccaatggccgtattccggccattatcgaccgagataac
gaggactttgtggtgttcgagtccggcgcaattcttctgtatctggcggaaaaaaccggt
aagttcttaccagccgatcctaaaaagcgctcacaggtcattcaatggctcatgttccaa
atgagcggtgtcggcccaatgatgggtcaagctaacgtgttttaccgttacttccctgaa
aaaattcccgcggccattgaacgttaccaaaaagaaggccgacgtttgtttgaggtaatg
aatacccagttagccaaacatcaatatctggccggtgatgaatacaccattgccgatatc
gcgacttggccttgggttcgcatccatgaatggagcggcatcaatatgcaaggactcact
cacttacagcgttggttagacgagctagccctgcgccccgcttgccaaaaaggcatagtg
acccctccgccttcggtcttgagtgatgaagagcgcgctaagcaaatccagaagatggtg
actaagtag

DBGET integrated database retrieval system