KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_3482Help
Entry
SHJGH_3482        CDS       T02531                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sho00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SHJGH_3482
Enzymes [BR:sho01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SHJGH_3482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(4002092..4003411)
Genome map
AA seq 439 aa AA seqDB search
MTPTAAEASPPGTKDVTAVLFEWNYASVAKECTTALGPAGYGYVQVSPPAEHIQGAQWWT
SYQPVSYKIAGRLGDRTAFRNMVNTCHAAGVKVVVDTVINHMSAGSGTGTGGSSYTKYDY
PGLYSVYDFDDCTSQVSNYSDRWNVQHCELVGLADLDTGEEYVRKTIAGYMNDLLTLGVD
GFRIDAAKHIPAGDLANIKSRLTNPSAYWKQEVIYGAGEAVQPSEYTGNGDVQEFRYAYD
LKRVFTSEKLAYLTNYGEGWGYLNSSVAGVFVDNHDTERNGSTLNYKSGADYTLANVFML
AWPYGAPDVNSGYEWSDADAGPPNGGQVNACWQDGWKCQHAWPEIKSMVAFRNATRGQAV
TNWWDNGNNAIAFGRGTKGYVAINHESSSLTRTYQTSLPAGTYCNVQNNTPVTVNSSGQF
TATLGSNTALALYAGKSSC
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaccccgacggccgccgaggcctccccgcccggcaccaaggacgtcaccgccgtcctc
ttcgagtggaactacgcctcggtggccaaggagtgcaccaccgccctcggccccgccggc
tacggatacgtccaggtctccccgcccgccgagcacatacagggggcgcagtggtggacg
tcgtaccagcccgtgtcctacaagatcgcgggccgcctcggcgaccgcacggccttccgg
aacatggtgaacacctgtcacgcggccggtgtgaaggtcgtcgtggacaccgtgatcaac
cacatgtcggcgggcagcggcaccggcaccggcggctcgtcgtacacgaagtacgactac
ccgggcctgtactcggtctacgacttcgacgactgcacctcccaggtgtcgaactactcc
gaccgctggaacgtgcagcactgcgaactcgtcggcctcgccgacctcgacaccggcgag
gagtacgtccgcaagaccatcgccgggtacatgaacgacctcctcaccctcggcgtcgac
ggcttccgcatcgacgcggccaagcacatcccggccggtgacctggcgaacatcaagagc
cgcctgaccaacccgtccgcctactggaagcaggaggtcatctacggcgcgggagaggcc
gtccagccctccgagtacaccggcaacggagacgtccaggagttccgctacgcctacgac
ctcaagcgcgtcttcaccagcgagaagctcgcctacctcaccaactacggcgagggctgg
ggctatctgaacagctcggtcgcgggcgtcttcgtcgacaaccacgacaccgagcgcaac
ggcagcacgctgaactacaagagcggcgccgactacaccctggccaacgtcttcatgctc
gcctggccctacggcgcccccgacgtcaactccggctacgagtggtcggacgccgacgcc
ggcccgcccaacgggggccaggtgaacgcctgctggcaggacggctggaagtgccagcac
gcctggccggagatcaagtccatggtcgccttccgcaacgcgacccgcggacaggcggtc
accaactggtgggacaacggcaacaacgcgatcgcgttcggccggggcaccaagggctac
gtggcgatcaaccacgagtcctcgtccctgacccgcacctaccagacgtccctcccggcc
gggacgtactgcaacgtccagaacaacaccccggtgacggtcaactccagcgggcagttc
accgccaccctcggctcgaacacggccctggcgctctacgccggcaagtcgagctgctga

DBGET integrated database retrieval system