KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_7159Help
Entry
SHJGH_7159        CDS       T02531                                 

Definition
(GenBank) aminotransferase
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sho00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SHJGH_7159
   00650 Butanoate metabolism
    SHJGH_7159
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SHJGH_7159
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SHJGH_7159
Enzymes [BR:sho01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SHJGH_7159
Amino acid related enzymes [BR:sho01007]
 Aminotransferase (transaminase)
  Class III
   SHJGH_7159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
8124935..8126218
Genome map
AA seq 427 aa AA seqDB search
MNDLYSRHRRVLPDWLALYYDDPIELSHGEGRHVWDTAGRRYLDFFGGILTTLTAHALPE
VTKAVSEQAGRIIHSSTLYLNRPMVELAERIAQVSGIPDARVFFTTSGTEANDTALLLAT
TYRRSNTVLAMRNSYHGRSFSAIGVTGNRGWSPTSLSPLQTLYVHGGVRTRGPFAHLDDR
AFIDACVADLKDVLGHTRPPAALIAEPVQGVGGFTSPPDSLYASFREVLKEHGVLWIADE
VQTGWGRTGDHFWGWQAHARSGPPDIVTFAKGIGNGMSIGGVIARSEIMNCLDANSISTF
GGTQITMAAGLANLTYLLEHDLQGNARRVGGLLIERLRAVGAQLPGVREVRGRGLMIGVE
LVRPGTDEADPQAVAAVLEAAREGGLLLGKGGGHDTSALRISPPLSLTVAEAEEGAAILE
QALRSTY
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgacctctactcccgccaccgcagggtcctgcccgactggctcgccctctactac
gacgacccgatcgagctcagccacggcgaggggcgccacgtctgggacaccgccggccgg
cggtacctggacttcttcggcggcatcctgaccacgctgaccgcgcacgccctgcccgag
gtgaccaaggcggtcagcgagcaggccggccggatcatccactcctccaccctctacctc
aaccggccgatggtcgaactcgccgagcggatcgcccaggtgagcggaatcccggacgcc
cgcgtgttcttcacgacctccggcaccgaggccaacgacaccgccctgctgctcgccacc
acctaccggcgcagcaacaccgtcctcgccatgcggaacagctaccacggccgctccttc
agcgcgatcggcgtcaccggcaaccgcggctggtccccgacctccctctccccgctccag
accctgtacgtccacggcggcgtacgcacccgggggccgttcgcccacctcgacgaccgc
gcgttcatcgacgcctgtgtcgccgacctgaaggacgtcctcggccacacccggccgccg
gccgcgctgatcgccgaacccgtccagggcgtcggcgggttcacctccccgccggacagt
ctctacgcctccttccgggaggtgctgaaggagcacggcgtcctgtggatcgccgacgag
gtgcagaccggctggggccgcaccggcgaccacttctggggctggcaggcgcacgcccgc
agcggcccgccggacatcgtcaccttcgccaagggcatcggcaacggcatgtccatcggc
ggggtcatcgcccgttccgagatcatgaactgcctggacgccaacagcatctccaccttc
ggcggcacccagatcaccatggccgccggcctcgccaacctcacctacctcctcgaacac
gacctccagggcaacgcccggcgcgtcggcggcctgctcatcgagcggttgcgggcggtc
ggcgcgcagctgcccggggtgcgggaagtgcgcggacgcgggctgatgatcggcgtcgag
ctggtcagaccgggcacggacgaggccgacccgcaggccgtcgcggcggtgctggaggcg
gcccgggagggcgggctgctcctcggcaagggcggcgggcacgacaccagcgccctgcgg
atcagcccgccgctgtcgctgacggtcgccgaggccgaggagggcgcggcgatcctggaa
caggcgctgaggagcacgtactag

DBGET integrated database retrieval system