KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_7270Help
Entry
SHJGH_7270        CDS       T02531                                 

Definition
(GenBank) neuraminidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sho00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SHJGH_7270
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SHJGH_7270
Enzymes [BR:sho01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     SHJGH_7270
Bacterial toxins [BR:sho02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   SHJGH_7270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(8238866..8240743)
Genome map
AA seq 625 aa AA seqDB search
MPSGLRARLGSALAIAALAAAGTVLPFLPAHPAHAQPAGGSPAFEQQVLFKAAQDPGYAC
FRIPAVVRTADGALLAFAEGRVLNCGDAADIDIVLKRSTDGGRTWGPLQVVNEGAGDTHG
NPAPVVDRVTGRVWLAQTYNTGRTDSAGCSVPCDRTPHLQYSDDGGRTWSPPRDLSPEIL
PADWNSWYATGPVHGIQLTRGRHAGRLVFGVNTETWDGSRVTANHAALIVSDDHGGHWRI
GATDTWPVAADGTFRQKPSELTLAERGDGSVLVSGREQDGTDLGHRTQAVSRDGGGSFTA
PFRDLPDLYTPQVQGSLLQLGDRLLLACPGDPDRRRTMMIRSSYDGGRTWDGVDRGTVVT
TDWSGYSDLVRVDSGTVGLLYEGGAVDARDEIRFARFTEDWPAPRRGPDPVTADLAPRAR
PAAVLGGPEATEGASGGALEFDGTDDAVRLPYRTGLPLGTKDFTVSLWFRYTATAGEQPL
LWMGGIGTSQPQVWLRGEPANNRVRGLITVRNGATPPQTASVSTGTAYNDGRWHHAVLRR
GGGLLSLSVDGALSSAADVPGSVSRNSPFGVHLGQRMDSRAFLTGALDEVRVWDRALTDA
ELADPQVLRSPQDTVLWLPLNRVRG
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
gtgccgtcaggtcttcgcgcccgtctcggatccgcactcgccatcgccgcccttgcggcg
gccggaacggtcctgccgttcctccccgctcatccggcgcacgcccagccggcgggcggt
tccccggcgttcgaacagcaggtgctgttcaaggccgcccaggacccgggctacgcgtgc
ttccgcatcccggcggtcgtcaggacggccgacggcgccctgctggcgttcgccgagggc
cgggtcctgaactgcggggacgcggccgacatcgacatcgtgctcaagcgctccaccgac
ggcgggcgcacctggggcccgttgcaggtggtcaacgagggcgccggggacacccacggc
aacccggccccggtggtggaccgcgtcaccggccgggtctggctggcccagacgtacaac
acgggccgtacggacagcgccggctgctcggtcccctgcgaccgcaccccgcaccttcag
tacagcgacgacggcggccggacctggtccccgccgcgcgatctgagccccgagatcctg
cccgccgactggaactcctggtacgccaccggtcccgtgcacggcatccagctcacccgc
ggccggcacgccggacgcctggtcttcggggtgaacaccgagacctgggacggcagccgg
gtcaccgccaaccacgcggccctgatcgtcagcgacgaccacggcggccactggcggatc
ggcgccaccgacacctggcccgtcgccgccgacggcaccttccggcagaagccctccgag
ctcacgctcgccgagcgcggcgacggctcggtcctggtcagcggacgggagcaggacggc
accgacctcggccaccgcacccaggccgtcagccgcgacggcggcggcagcttcaccgcg
cccttccgcgacctgccggacctgtacaccccgcaggtgcaggggtcgctgctgcaactg
ggcgaccgcctgctgctggcctgccccggcgaccccgaccggcgccgcacgatgatgatc
cgctcctcctacgacgggggccgcacctgggacggcgtggaccgcggcacggtcgtcacc
acggactggtccggctactccgacctggtgcgggtcgactccgggacggtcggcctgctg
tacgagggcggcgccgtggacgcccgcgacgagatccgcttcgcccgcttcaccgaggac
tggccggccccgcgccgcggccccgacccggtcaccgccgacctcgccccgcgcgcccgc
ccggcggcggtgctgggcgggccggaggcgacggagggggcatccgggggcgcgctggag
ttcgacggcaccgacgacgccgtacgcctgccgtaccgcaccgggctcccgctgggcacg
aaggacttcacggtgtcgctgtggttccggtacacggcgacggccggggagcagccgttg
ctgtggatgggcgggatcggcaccagccagccgcaggtgtggctgcgcggggagccggcg
aacaaccgggtgcgggggctgatcaccgtgcggaacggagccaccccgccgcagaccgcg
tccgtgtcgacgggcaccgcgtacaacgacggccggtggcaccatgccgtgctccgccgc
ggcgggggtctgctgtcgctgtccgtcgacggtgcgctgtcctccgccgccgatgtgccg
ggctccgtcagccgcaactcccccttcggcgtgcacctcggtcagcgcatggacagccgt
gccttcctcaccggcgcgctggacgaggtgcgcgtctgggaccgggcgctcaccgacgcc
gaactcgccgatcctcaggtgctgcgctcaccgcaggacacggtcctgtggctgcccctg
aaccgcgtgcgcggctga

DBGET integrated database retrieval system