KEGG   Sarcophilus harrisii (Tasmanian devil): 100917457Help
Entry
100917457         CDS       T02286                                 

Gene name
KMT5B, SUV420H1
Definition
(RefSeq) lysine methyltransferase 5B
  KO
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100917457 (KMT5B)
Enzymes [BR:shr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100917457 (KMT5B)
Chromosome [BR:shr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100917457 (KMT5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
6
AA seq 899 aa AA seqDB search
MKWLGDSKNMVVNGRRNGGKLSNEHQPSQSKFQHAGKDALKAGRNAVERRSSRCSGASGF
EGQSRYVPSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTSAFPWRSSRHFTKSDSCP
HTHPVRFRPIKGRQEELKEVIERFKKDEHLEKAFKCLTSGEWARHYFLNKNKAQERLFKE
HVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEEN
MLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPG
EEISCYYGDGFFGENNEYCECYTCERRGTGAFKSRVGLPTPTPVINSKYGLRETDKRLNR
LKKLGDGSKNSDSQSVSSNTDADTTQEKADAAANRKPSVGVKKSSKNRSLTRPSSSVSRI
PAASNSTSSKLTPLHNPRVPKKLKRPVIKPLLSKIKLRNQCRRPEQKSSSRKLEVGNLVL
KEPKVVLYKNLPIKKDRASEGAGGAAAAGGCLTRHAAREHRQGPLNGAPEQDGESPCTYI
TRRSVRTRTGWKETSEPALEPSLPGSPPGTWTGPGPGTDTDATEPPTAHAVHDQQKAYES
TASPKGEGRSPKEDASTAKKKSRPGKLLKPFPKVEEPAPALDPRARRRALGAHDEPSGSD
SDSGQHRTTWGSCRLLCKSLSSEPGGQQMAGVTGGGRGSRGALGSGKPRPHLPWEAVHSL
GCSQAWQSVRKGPQLLRTPSGPYNSIRHRLPDGRLSAVACCLSGVSAHKHSEAIGDAVSR
GCSSLTKAGSSELLGKTAVFQDLPRGGFLGKGDGGYGVDTGLGGWKTPAVSPKSVLQGRA
AEQSRSPPHPSLPAMAVGTLSVSSSPSPRRQLLDGSHSPSFPPQAPPSCPPTFWQQAVT
NT seq 2700 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggttgggagactccaagaacatggtcgtgaatggcaggagaaatggaggcaag
ttgtctaacgaacaccagccgagtcaatccaaatttcagcacgcgggaaaggacgccctg
aaagctggcagaaatgcagttgagaggaggtcaagcagatgtagcggtgcttcagggttc
gagggccagagtcgctatgttccttcttcggggatgtctgccaaggagctatgtgaaaat
gacgacctagccaccagcctggtgcttgacccctacctaggctttcagacccacaagatg
aacacgagcgcctttccttggaggagttccaggcacttcactaaatcggacagctgccct
cacacgcacccggtgagatttcgtcctattaaaggaaggcaagaagagctgaaggaggtg
attgagcgctttaagaaagacgagcacttggagaaggccttcaaatgcctgacctcgggc
gaatgggcacggcactattttctgaacaagaataaggcacaggagcggttgttcaaagaa
cacgtatttatttatttgcgaatgtttgcgactgacagtggatttgaaatcctgccgtgc
aatcgatattcttcagaacagaatggagccaaaatcgttgcgacaaaagagtggaaacgg
aacgacaagatcgagttgctggtggggtgtatcgctgaactctcggaaatagaggagaac
atgcttcttcgacatggagagaacgacttcagcgtcatgtactccaccaggaaaaactgt
gctcagctctggctcggtcccgccgcctttataaaccatgattgcagacctaactgtaag
tttgtctcgacgggtcgtgacaccgcctgtgtgaaggccttgagagacatcgagcccggg
gaggaaatctcctgttattatggagacgggtttttcggagaaaacaacgagtactgcgag
tgttacacttgtgaaagacggggaactggtgcttttaagtcgagagtggggcttcccacc
cccactcccgtcatcaacagtaaatacgggctgagagagaccgacaagcgcttaaaccgg
ctgaagaagctgggtgatggcagcaagaactcggacagccagtcggtcagctccaacacg
gacgcagacaccactcaggaaaaagccgacgcggctgctaacaggaaaccgtccgtcggc
gtaaagaagagcagcaagaaccgatcgctcacgcgcccgtcgtcgtcggtgtcgcggatc
ccggcggcctccaactctacctcatcgaaactcactcctctccacaatcccagggtacca
aagaaactgaaaaggcctgtcatcaagcctttgctctccaagataaagctcagaaaccag
tgccggcggccagagcagaagagctcctccagaaagctagaggtggggaacctggtcctc
aaggagcccaaggtggttctctacaaaaacttgcccattaaaaaggacagagcgtcggag
ggagcggggggtgccgccgcggccggcggctgcctcacccgccacgcggcccgggaacac
cggcaggggcccctgaacggggctcccgagcaggacggggagtccccctgcacctacatc
actcggaggtcagtgaggacgagaaccgggtggaaggagacctctgagcccgccctcgag
ccgagcctgccgggcagccctcccggcacctggacgggcccaggccccggcacagacacg
gacgccacggaaccacccaccgcccacgcggtgcatgaccagcaaaaagcctacgagtcc
actgcgtccccaaagggggagggcaggtctccaaaggaggacgccagcacggccaaaaag
aaatcacggccagggaagcttctgaaaccatttcccaaagtggaggagcccgcgccggcc
ctggacccaagagcgcggcgccgggcccttggggcccatgacgaaccaagcggctccgat
tccgactcgggccaacatcggaccacgtggggttcctgccgactcctctgtaagtccttg
agctcggagcctggaggccagcaaatggctggggtgacgggcggcggtcgcgggtcccgc
ggcgccctcgggtccgggaagcctcggcctcatctcccgtgggaggccgtgcattctctg
ggctgctcccaagcttggcagtctgtccgcaaggggccccaactcctccggacgccctct
ggtccttacaacagcatacgccatcgactccccgatggaagactcagtgccgtagcttgc
tgcctctcaggggttagtgcgcacaagcattcggaagccattggagatgccgtctcgagg
ggctgctcttccctcactaaggctggaagttcagagctgctgggaaaaaccgcagtattc
caggatttgccaagagggggctttctgggtaaaggggatggcgggtatggggtggacact
ggcctgggaggctggaagacccctgcggtttctcctaagagtgttttgcagggccgggca
gcagaacagtcacgttcccctccacaccccagcctgccagccatggccgtgggcaccctc
tcagtctccagctctccgtcaccccgcagacagctgctagacgggagccacagtccctcc
ttccctccgcaggctcctccctcctgccccccaacattctggcagcaggcagtgacctag

DBGET integrated database retrieval system