KEGG   Sarcophilus harrisii (Tasmanian devil): 100920746Help
Entry
100920746         CDS       T02286                                 

Gene name
GAD2
Definition
(RefSeq) glutamate decarboxylase 2
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00250  Alanine, aspartate and glutamate metabolism
shr00410  beta-Alanine metabolism
shr00430  Taurine and hypotaurine metabolism
shr00650  Butanoate metabolism
shr01100  Metabolic pathways
shr04727  GABAergic synapse
shr04940  Type I diabetes mellitus
Module
shr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    100920746 (GAD2)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100920746 (GAD2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100920746 (GAD2)
   00430 Taurine and hypotaurine metabolism
    100920746 (GAD2)
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    100920746 (GAD2)
 Human Diseases
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    100920746 (GAD2)
Enzymes [BR:shr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     100920746 (GAD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 100920746
NCBI-ProteinID: XP_003771904
Ensembl: ENSSHAG00000013305
UniProt: G3WJK8
LinkDB All DBs
Position
5
AA seq 587 aa AA seqDB search
MASTGSGFWSFGSEDGSGDPENPSTARAWCQVAQKFTGGIGNKLCALLYGDAEKPMETSG
SEKETQGSADKKTVCTCNQKPCSCPKTDLNYACLHSTDLLPACNGEVATLSFLQDVMDIL
LQYVVKSFDRSTKVIDFHYPNELLQEHNWELADQPQTLEEILSNCRTTLKYAIKTGHPRY
FNQLSTGLDMVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLRKMREIVGWPGGSGDGI
FSPGGAISNMYAMLIARFKMFPEVKEKGMAAIPRLVAFTSEHSHFSVKKGAAALGIGTDS
VILIKCDERGKMIPSDLERRIVEAKQKGFVPFLVSATAGTTVYGAFDPLLAIADICKKYK
IWMHVDAAWGGGLLMSRKHKWKLNGVERANSVTWNPHKMMGVPLQCSALLVREEGLMQSC
NQMHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTIGFEAQIDKCLELA
EYLYNLIKNREGYEMVFDGKPQHTNVCFWYIPPSLRHLEDNEERMSRLLKVAPVIKARMM
EYGTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atggcatctacgggctctggcttttggtccttcgggtccgaagatggctccggagacccg
gagaaccccagcacagctagagcctggtgccaggttgcccagaagttcaccggaggcatt
ggaaacaaactctgtgccttgctgtatggagacgctgaaaagccaatggaaacttccggc
agcgagaaggagactcagggatcagccgataaaaagactgtctgtacttgcaatcaaaag
ccctgtagctgccccaaaacggatctcaattacgcgtgtttacactcaacagatctgttg
ccagcatgtaacggagaagtggccactttgtcttttctccaagatgtaatggacattttg
cttcagtatgtggtgaagagttttgatagatcaacaaaggtgattgatttccattaccca
aacgagcttcttcaagaacataattgggaattggcagatcagccacagaccctggaggaa
attttgtccaactgcagaacaactctaaaatatgcaatcaaaacaggtcatcctagatat
ttcaatcaactttctactggattggatatggttggattagcagcagactggctaacttca
acagcaaatactaatatgttcacctatgaaattgctccagtgtttgtacttttggaatat
gtcacattaaggaaaatgagagaaattgtcggctggccggggggcagtggtgatgggatc
ttttcacctggtggtgccatatctaacatgtatgctatgttgattgcacgtttcaagatg
tttcccgaagtcaaagagaaaggaatggcagctattcccagactggttgccttcacatct
gagcatagtcacttttcagtaaagaagggagctgcagccttggggattggaacagacagt
gtgattctgatcaaatgtgatgaaagaggaaaaatgattccatctgatctggagagaaga
attgttgaagctaaacaaaaaggatttgttcctttccttgtgagtgccactgccgggacc
acagtgtatggcgcatttgatcctctgctagctattgctgacatctgcaagaaatataag
atctggatgcatgtggacgcagcttggggtggcggactcctgatgtcccggaaacataaa
tggaagcttaatggcgtggaaagggccaactctgtgacatggaaccctcacaagatgatg
ggcgtccccttgcagtgctcagctctgctggtgagagaagaggggttgatgcagagctgc
aaccagatgcatgcttcttacctctttcaacaagataaacactacgatttgtcttatgat
accggagacaaggctttacagtgtgggcgccatgttgatgttttcaaattatggctaatg
tggagggcaaaggggaccatcggatttgaagcacagattgacaagtgtttggagcttgca
gagtatttatacaaccttataaaaaacagagaaggatatgaaatggtgtttgatggaaag
cctcagcacacaaatgtctgcttctggtatatccccccaagtttgcggcacttggaagac
aatgaagaaagaatgagtcgcctcttaaaggtcgcccctgtgattaaagccaggatgatg
gagtatggaaccaccatggtcagctaccaacccttgggagataaagtcaatttctttcgc
atggtcatctcaaatccagcagcaactcatcaagacatcgatttcctgattgaggaaata
gaacgtcttggacaggatttataa

DBGET integrated database retrieval system