KEGG   Sarcophilus harrisii (Tasmanian devil): 100928904Help
Entry
100928904         CDS       T02286                                 

Gene name
SETDB1
Definition
(RefSeq) histone-lysine N-methyltransferase SETDB1 isoform X2
  KO
K11421  histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00310  Lysine degradation
shr04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100928904 (SETDB1)
 Cellular Processes
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100928904 (SETDB1)
Enzymes [BR:shr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100928904 (SETDB1)
Chromosome [BR:shr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100928904 (SETDB1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100928904 (SETDB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET MBD DUF4537
Motif
Other DBs
NCBI-GeneID: 100928904
NCBI-ProteinID: XP_003770007
Ensembl: ENSSHAG00000012701
UniProt: G3WHI2
LinkDB All DBs
Position
4
AA seq 1277 aa AA seqDB search
MTSFPGCFGLGAAAAGMEPQEIAELQQAVVEELGISMEELRQFIDEELEKMDCVKQRKRQ
LAELESWVVQKETEVAHVDELFDEASRAVTNCETLVKDFYSKLGLQYRESSSEDEASKPT
EVIEIPDEDDDVLSVDSGDAGSRTPKDQKLREAMAALRKSAQDVQKFMDAVNKKTSSQDL
NKGALGQVPVELSKDGDLVVSMRILGKKRTKTWHKGTLIAIQTVGAGRKFKVKFDNKGKS
LLSGNHIAYDYHPPADKLYVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKLRFLIFFDDG
YASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYITAYPNRPMVLLKSGQLIKTEWEG
TWWKSRVEEVDGSLVKILFLDDKRCEWIYRGSTRLEPMFSMKTSTASTLEKKQGGQLRTR
PNMGAVRSKGPVVQYTQDLTGTGTQFKPLEPPRTPSLPAPTLSPQVADLESLESQLAQAR
KQVAKKSTSFRLGSVGSGHSSPTSPGLNEAVPGGKSAVGQTVRLTPGSATPGPTFPAFHG
MLERAPAEPSYRAPMEKLFYLPHACSHTCLTRVRPVSNAQYRGKNPLLVPLLYDFRRMTA
RRRVNRKMGFHVIYKTPCGLCLRTMNEIERYLFETSCDFLFLEMFCLDPYVLVDRKFQPY
KPFYYILDITHGQEDVPLSCVNEIDTTPPPQVAYSKERIPGKGVFINTGWEFLVGCDCKD
GCRDKSKCACHQLTIQATACTPGGQINPNSGYQHKRLDECLPTGVYECNKRCKCNINMCT
NRLVQHGLQVRLQLFKTQNKGWGIRCLDDIARGSFVCIYAGKILTDDFADKEGLEMGDEY
FANLDHIESVENFKEGYESDAPCSSDSSGVDLKDQEDGNSGTEDPEESNDDSSDDNFCKD
EDFSTSSVWRSYATRRQTRGQKENGTSETASKDSRPTDSGTPHLSAPQTSMGGCKPPSSE
DTPKNKVATWLSCNNVSDSSFADSDSRSSFRTSEGGDGRAGVGRGDGEKPSVSGLGVKEE
GDIKAPKKEESDEQSKIVLSSEGSRTFGYNPSPLKTEGIKGPPSKTNIHQARRLVAPAQA
NPDDVLTLSSSTESEGESGTSRKPVAGQAPATAADSDDIQTISSGSDGEDYEDKKNLSGP
IKRQVAVKSTRGFALKSTHGIAIKSTNMASADKGESVPVRKNTRQFYDGEESCYIIDAKL
EGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKRIRAGTELTWDYNYEVGSVEG
KELLCCCGAIECRGRLL
NT seq 3834 nt NT seq  +upstreamnt  +downstreamnt
atgacctcttttcctgggtgttttggtttgggtgctgctgcagctgggatggaacctcag
gagattgctgagctgcagcaagctgtggtggaggagctgggcatctctatggaagaactt
cgacagtttattgatgaggaattagaaaagatggattgtgtaaaacagcgcaagagacaa
ctcgctgagctggaatcctgggtggttcagaaagagactgaggtcgcccatgttgatgag
ctctttgatgaagcatccagggcagtgactaactgtgaaactctggtgaaagatttctac
tccaaattggggctgcagtatcgagagagcagttctgaagatgaagcttctaaacccaca
gaagtaattgagattcctgatgaggatgatgatgtcctcagtgttgattcaggtgatgca
ggcagtagaaccccaaaggaccagaagcttcgagaagctatggctgccctgaggaagtca
gcccaagatgtccaaaagttcatggatgctgtcaacaagaagactagttctcaggacctg
aacaaaggggccttgggtcaagtccctgttgagttgagtaaggacggtgacctggttgtc
agcatgagaatcctgggcaagaaaaggaccaagacatggcacaaggggaccctcattgcc
atccagacagttggggctgggaggaagttcaaagtcaaatttgacaacaaagggaagagc
ctgttgtctgggaaccatattgcctatgactaccaccctccagcagacaagttgtatgta
ggcagccgtgtggtggccaagtataaggatgggaatcaagtctggctctatgctggcatc
gtagctgagactccaaatgtcaaaaacaaactcaggttcctcatcttctttgatgatggc
tatgcatcctatgtcacacagtctgagctctatcccatctgcagaccattgaagaagact
tgggaggacattgaggatatttcctgcagagacttcattgaagaatatatcactgcctac
cccaaccgtcctatggtactccttaagagtgggcagctcataaagactgaatgggaaggc
acttggtggaagtcgcgtgtggaagaggtggatggcagtcttgtcaagatcctgttcctg
gatgacaagcgctgtgaatggatctatcgaggctctacccgactagagcccatgttcagc
atgaagacatccacagcttccaccctggagaagaaacaaggggggcagcttcggacacgc
ccaaacatgggtgctgtaaggagcaaaggtcccgtggtacagtatactcaagatctcact
ggtactggaacccagttcaagcccctagaaccacctcgcactccctctttgcctgcccct
actctgtcccctcaggtggctgatttggagagtctggagagtcagctcgcccaagcacgg
aagcaagtggccaaaaagagtacatctttccggctaggttctgtgggctctggtcattca
tcccctacatcccctgggcttaacgaggcggtccctggcgggaagtctgcagttggccag
acagtgagattaacaccaggctctgcgacccctggcccaactttcccagcttttcatggc
atgctggagcgggctccagctgaaccctcctatcgggcccccatggagaagcttttctac
ttgccgcacgcctgtagtcacacctgcctcacccgagtgaggccggtgagcaacgcacag
taccggggcaagaaccccctgttggtccctctgctctatgactttcggcgcatgacggcc
cggcgccgggtcaaccgcaagatgggctttcacgttatctataaaacaccctgcggcctt
tgcctgaggacgatgaatgagattgaacgctacctctttgagacaagctgtgatttcctt
ttcctggagatgttctgtttggacccttatgttcttgtggatcggaaattccagccctat
aagcctttttactacatcctggacatcacccacggccaggaggatgttcctctctcgtgt
gtcaacgagattgataccacccccccgccacaggtggcctacagcaaggagaggatccca
gggaaaggtgtcttcatcaacacgggctgggagttcctcgttggctgtgactgcaaggat
ggttgtcgggacaagtctaaatgtgcttgccaccaacttactatccaggcaacagcctgt
actcccggaggccagatcaaccctaactctggctaccagcataagagactagatgagtgc
ctgccgacaggggtatacgaatgtaacaagcgctgcaaatgtaacatcaatatgtgcaca
aaccgcttggtacaacatgggctacaggtccgactgcagctcttcaagacccagaacaag
ggctggggcatccgttgtttggatgacatcgccagaggctcctttgtctgtatatatgca
ggcaaaatcctgactgatgactttgcagacaaggagggtctggaaatgggggatgagtac
tttgcaaacctggaccacattgaaagtgtggagaactttaaggaaggctatgaaagtgat
gccccctgctcctctgacagcagcggggtggacttgaaggaccaagaggatggcaacagt
ggtaccgaggaccctgaagagtccaatgatgacagttcggatgacaacttctgcaaagat
gaggattttagtaccagttcagtctggcgcagctatgccacccggcggcagacaagaggc
cagaaagagaatgggacatcggagacggcttccaaggactcccgccccactgactcgggg
accccccacctttctgcccctcagacttctatggggggttgtaaacctccttcctctgag
gacacgcccaagaacaaagtagccacatggctaagctgcaacaatgtcagtgacagtagc
tttgctgactcagatagccgctcctccttcaggaccagtgaaggtggagatgggagggct
ggggtaggccgtggggatggagagaagccctccgtctcagggttaggggtcaaagaagag
ggggatatcaaggcacccaagaaagaggagtctgatgaacagagcaagattgtgttgtct
agtgaaggttccaggacttttggatacaacccatcccccttgaagactgagggtatcaag
ggcccacctagcaagaccaatatacatcaggcccggaggcttgtggcgcctgcacaagcc
aatcctgatgatgttctgacattatccagcagcacagaaagtgagggggagagtgggaca
agccgaaaacctgtagctggtcaggctccagccacagcagctgacagtgatgacatccag
accatctcctctggctctgatggcgaggattatgaagacaagaagaacctgtctggccca
atcaaacggcaggtggctgtgaaatctacacgaggttttgctttaaaatcaacacatggc
attgctataaagtcaaccaatatggcgtctgcagacaagggtgagagcgtgcctgttcgc
aagaatacacgccaattctatgatggcgaggagtcttgctacatcattgacgccaagcta
gaaggcaacctgggccgctatctgaaccacagctgcagtcccaacctgtttgtccagaat
gtcttcgttgacacccatgaccttcgtttcccctgggtggctttctttgccagcaagagg
atacgagctgggacagagctgacctgggactataactatgaggtgggcagcgtggaggga
aaggagcttttgtgctgttgtggagccatagaatgtcgaggacgacttctttaa

DBGET integrated database retrieval system