KEGG   Sarcophilus harrisii (Tasmanian devil): 100932537Help
Entry
100932537         CDS       T02286                                 

Gene name
ACE
Definition
(RefSeq) angiotensin-converting enzyme isoform X1
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04614  Renin-angiotensin system
shr04924  Renin secretion
shr05142  Chagas disease (American trypanosomiasis)
shr05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:shr00001]
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    100932537 (ACE)
   04614 Renin-angiotensin system
    100932537 (ACE)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100932537 (ACE)
  Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    100932537 (ACE)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     100932537 (ACE)
Peptidases [BR:shr01002]
 Metallo Peptidases
  Family M2
   100932537 (ACE)
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100932537 (ACE)
CD molecules [BR:shr04090]
 Proteins
  100932537 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 100932537
NCBI-ProteinID: XP_012403926
Ensembl: ENSSHAG00000010621
LinkDB All DBs
Position
4
AA seq 1300 aa AA seqDB search
MVFPSRGCPGPLVRQVVSLLMLAGLLLPPAQALPNELLPGDFPADEKGAADFAKSYNSTA
ETVLYQSTLASWNYNVNISKENAKLQEEADLFSQEFTEAWGLKAKKLFDPIWKNFTDPLL
QKVINSIRILGSANLPLEQRQKYNTLLSKMTSIYSSAKVCFPNKTATCWALEPELTEIMA
SSRSYSKLLFAWEGWHNAVGIPLKPEYQSYVNLSNEASKMDGFKDTGEYWRSWYNSPTFT
EDLERLYQQLEPLYLNLHAFVRRGLHRRYGDKYINLRGPIPAHLLGNMWAQSWENIYDLV
VPFPNKPNLDVTNTMVQKGWNATHMFHVAEEFFTSLGLLPMPPEFWAKSMLEKPNDKREV
VCHASAWDFYNRKDFRIKQCTRVTMDQLSTVHHEMGHIQYYLQYKNQPVSLRAGANPGFH
EAIGDVLALSVSTPTHLNKIGLLDKVINDNENDINYLLKMALEKIAFLPFGYLVDQWRWR
VFSGVTTPSQYNSDWWYLRTRYQGICPPITRNETHFDAGAKYHVPAVTPYIRYFVSFVLQ
FQFHKALCAEAGYSGPLHYCDIYQSQKAGDKLREVLQAGASRSWQEILKGLTGTETLDAG
PLLEYFQPLISWLQQQNQNNGEVLGWPEFDWRPPVPDGYPEGIDKLTDEAEAEKFLEEYD
RLGQGIMNAYVEASWAYNTNITEENSKIMLEKNLELSSFTLQYGTRARQFDVSSFQKSSV
TRLLGKLQDLGRAALSPTELDKYNKILLNMESAYSTAKVCRQGGSCVPLEPDLTELMASS
QDYDNLLWAWKGWRDKAGRAILPHFSEYVELSNKAAQLNGYADSGASWRAQYEKPSLEQD
LEKIYLELQPLYQNLHAYVRRALFRHYGPNHINLQGPIPAHLLGNMWAQTWSNIYKLMVP
FPSASQVDATPAMKEQGWTVRRMFEEADKFFQSLGLLPLPPEFWNKSMLEKPNDSREVVC
HASAWDFYNGKDFRIKQCTTVNMEDLIVIHHEMGHVQYFMQYKDQPIAFREGANPGFHEA
IGDVLALSVSTPKHLHSIGLLDNEGEGYESEINYLMSVALDKIAFIPFGYLIDQWRWRVF
DGSINKKDYNQEWWSLRLKYQGLCPPVPRTQEDFDPGAKFHIPANVPYLRYFVSFVIQFQ
FHEALCRAAGHTGPLHKCDIYQSKEAGKLLSDAMKLGLSKPWPEAMMLLTGQPNMSATAI
VKYFQPLLDWLITKNKEQEETLGWPQYDWTPYGASRAPNSDKISFLGMELTSGQAKAGQW
TLLVLGLAFLMAIIGLAYKTYKLKRRQEPYFSSEVELRHS
NT seq 3903 nt NT seq  +upstreamnt  +downstreamnt
atggtcttcccatcccggggctgccccgggccgctcgtgcggcaagtcgtctcgctgctg
atgctggccggactgcttctgccgcccgcccaggccctgcccaacgagctgctgcccggg
gactttcccgcagatgagaaaggggctgcagacttcgccaagagctacaactctacagcg
gagaccgtcctgtaccagagcaccttagctagctggaattacaacgtcaacatcagcaaa
gagaacgcaaagctgcaggaggaagcagacctattttctcaagaattcactgaggcatgg
ggtctgaaagccaagaagttgtttgaccccatctggaagaacttcactgaccccctgctt
caaaaggtcataaattctattcggatcttgggctccgccaatctgcccctagagcagcgt
cagaagtacaataccttgctgagcaaaatgaccagcatatattcttcagccaaggtctgc
tttcccaacaagactgccacctgctgggccttggaaccagagcttacagaaatcatggcc
tcatcaaggagctacagtaagctgctgtttgcctgggagggctggcacaatgctgtaggg
attcctctgaaacctgaatatcaatcttatgtcaatctcagcaatgaggcttccaagatg
gatggctttaaggatacaggagaatactggcgttcttggtataattcacccacattcacg
gaagacctagaacgactgtaccaacagctggagccactctacctgaatctccatgctttt
gtacgccgtggcttgcaccgccgctatggagacaagtacatcaatctccgtggccccatt
cctgctcatcttctgggaaacatgtgggcacagagttgggaaaacatctatgacctggtg
gttcctttcccgaacaagcccaatctcgatgtcaccaacaccatggtgcagaagggctgg
aacgccacacacatgttccacgttgccgaagaattctttacgtccctggggctactgcct
atgcctccagagttctgggccaagtccatgctggagaagccgaatgataaacgagaggtg
gtatgccatgcctctgcctgggacttctacaacaggaaagattttaggattaagcagtgc
acaagagtgaccatggaccagctgtccactgtacatcatgagatgggccacatacagtat
taccttcagtacaaaaatcagcctgtttccctgcgagcaggtgccaaccctggtttccac
gaagccatcggggatgtgctagccttatcagtctccacacctactcatctaaacaaaatc
ggcctgttggacaaagttatcaatgacaatgaaaatgacatcaactacctgttgaagatg
gcactagaaaagattgccttcttgccctttggttacctggtggaccagtggcgttggagg
gtctttagtggggtcacaactccatctcagtacaactctgattggtggtaccttcggact
agataccagggcatctgccctcccataacccggaatgaaacccactttgacgctggagca
aagtatcatgtcccggctgtaacaccatacatcaggtattttgtgagctttgtcctgcag
ttccagttccacaaagctctgtgtgctgaggcgggctacagcgggcccctgcactactgt
gacatctaccaatctcaaaaggctggtgacaaactcagggaggtactgcaagcaggtgct
tctcggagctggcaggaaatacttaaggggctgacaggcacagagactctggatgcagga
ccacttcttgaatacttccagcctctcatcagttggctgcaacaacagaaccagaataat
ggcgaggtcctgggctggcctgaatttgactggcgtcctccagtgccagatggctatcca
gagggcattgacaagctgactgatgaagcagaggctgagaagttccttgaggaatatgac
cggttgggacaaggcataatgaatgcatacgtagaggccagctgggcttacaacacaaac
atcacggaggaaaatagcaagattatgttggaaaagaacctggaattatcttctttcacc
ctacaatatggcacccgtgcccgccagtttgacgtcagcagtttccagaaatcatcagtg
acacgactcctaggaaagcttcaagatttaggtcgggcagccctgtctccaacagagttg
gataagtacaataagatcctgttgaacatggagtcagcttacagtacagccaaagtgtgc
cggcaaggtggttcctgtgtacccctggagcctgatttgacggagttgatggcctcatcc
caggactatgacaacctgctatgggcatggaagggttggagggataaggcaggacgggct
attcttccccacttctcggagtatgtggaacttagcaacaaggctgcccagctcaatggc
tatgctgattctggagcttcctggagagcccagtatgaaaaaccttccctggagcaggat
ctggagaaaatctacctggaactgcagcccctctaccagaacctccatgcctacgtccgc
cgtgctctgttccgtcattatggacccaaccacatcaaccttcaggggcccattcctgct
catctattaggcaatatgtgggctcagacctggtccaatatctataaattgatggtaccg
ttcccttctgccagccaggtggatgctactccagctatgaaggaacagggctggactgtg
cggaggatgtttgaagaggcagataaattcttccagtcccttggcctgctgcccttgccc
cctgagttctggaataaatcaatgctggagaaaccaaatgatagccgagaagtggtgtgc
catgcttctgcctgggatttctacaatggcaaagacttcaggattaaacagtgcacaaca
gtgaatatggaggatctcatcgtcatccaccatgagatgggccatgtgcagtatttcatg
caatacaaagaccaacctatagccttccgagagggtgctaacccaggtttccatgaggct
atcggagatgtgctggcactctctgtctccacccccaagcacttacacagtattggtctg
ctggataatgagggcgagggctatgagagtgagatcaactatctgatgagtgtcgcactg
gacaagattgccttcattccttttgggtaccttattgaccaatggcgctggcgggtgttc
gatgggagcatcaacaagaaagattacaaccaggagtggtggagcctcaggctaaagtac
cagggtctctgtccaccagtgcctaggacacaagaagactttgacccaggcgccaagttt
cacatacctgcaaatgtgccctatctcagatactttgtcagttttgtgattcagttccag
ttccacgaggccctgtgccgagctgccggtcacacaggtccactgcacaagtgtgatatc
tatcaatcaaaggaggcagggaagctcttgtcggatgctatgaaactaggactcagtaag
ccctggccagaggctatgatgcttctgacgggacagcccaacatgtcagccacagctatt
gtgaaatacttccagcccctgctggactggctcatcaccaagaacaaggaacaggaagag
accctgggatggcctcagtatgactggactccatatggtgcctccagagcccccaacagt
gacaaaatcagcttcttgggaatggagctgacgtctgggcaggctaaagcagggcagtgg
accctgcttgttctgggcctggcgttccttatggctataataggcttggcctataaaaca
tataaactcaaaaggcgacaagagccttattttagctctgaggtggagctgagacactcc
tga

DBGET integrated database retrieval system