KEGG   Stereum hirsutum: STEHIDRAFT_104983Help
Entry
STEHIDRAFT_104983 CDS       T03127                                 

Definition
(RefSeq) glycogen synthase
  KO
K00693  
glycogen synthase [EC:2.4.1.11]
Organism
shs  Stereum hirsutum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    STEHIDRAFT_104983
Enzymes [BR:shs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     STEHIDRAFT_104983
Glycosyltransferases [BR:shs01003]
 Polysaccharide
  Storage polysaccharide
   STEHIDRAFT_104983
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
LinkDB All DBs
Position
Unknown
AA seq 754 aa AA seqDB search
MATSISEEKRDVRNPILFECAWEVANKVGGIYTVIKTKVPVTVSEYGDRYTLIGPLSYKT
APMEVEAEEPTDPHVAASLDAMRAQGVKVLYGRWLIEGAPRVLLFDTGSQYHRLDEWKGD
LWNLAGIPTPPNDHETNETILFGYLVAWFLGEYVSRQYHSAVIAHFHEWQAGVAIPLCRK
RHIDVTTVFTTHATLLGRYLCAGSVDFYNNLQYFDVDHEAGKRGIYHRYCIERSSAHCAD
VFTTVSHITAFESEHLLKRKPDGVLPNGLNVVKFQAMHEFQNIHAKAKEKINEFVRGHFY
GHFDWDLDNTLYLFTAGRYEFRNKGIDMFIESLARLNFRLQKLGSNITVVAFLIHPAATN
SYTIDSLKGQAVTKQLHDTVTEIQNRIGSRLFDLAAKSNGDFSKFPKTSDLLSDEDKILL
KRRIFALKRNSLPPVTTHNMVDDANDPILNQIRRVKLFNDAHDRVKVVFHPDFLSSNNPV
LGLDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQDMIDRPEDE
GCYIIDRRMQSAEDSVNSLADSLFSFSQKTRRQRINQRNRVERLSPLLDWKNLGIEYSKA
RQLALRRAYPDAFVGLTPNGMGVDGEEEDEFDFEKGPERLALSMPGSPRFKMGGLATPGD
MGTLTEEMQTLHTSDYRGYAWPGSQEEDDDAYPFPLVMKVRSRASSVMSGASTPGGGPFK
SLSERDLQKADAALSMVNGNGNGNGNGAFNGKSS
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atggcgacatccatctcagaagaaaaacgcgacgttcgcaatccgattttgttcgagtgc
gcctgggaggtcgccaacaaggtcggcggcatctacaccgtcatcaagacaaaagtgccc
gtcacagtatcagagtatggcgacagatacaccctcataggccctctatcttacaagacc
gcacccatggaagtcgaagcggaggagcccactgaccctcacgtcgcggcttcgctcgac
gcgatgcgtgcgcagggagtcaaggtgctctatggacggtggttgatcgaaggcgcgccc
cgcgtcttgcttttcgatactggtagccagtaccaccgcttggacgagtggaagggtgac
ttgtggaatctggctggtattccgactcctccgaatgatcacgaaacgaacgagacgatt
ctctttggatacctagtcgcttggttcctcggcgagtacgtgtcgcgtcaataccacagc
gctgtcattgctcacttccacgaatggcaagctggcgtcgcaattcccctgtgccgaaag
cgccacatcgacgtgaccactgtcttcaccacccatgctacccttctcggtcgctatctc
tgcgctggctccgtcgacttctacaacaacctccaatatttcgacgtcgaccacgaagcc
ggcaagcgtggtatctaccaccgctattgcatagagcgttcctctgctcactgcgccgac
gtattcaccacggtctcccacattaccgcgttcgagtcggagcacttactcaagcgcaaa
cccgatggtgtcctccctaacggtctcaacgtcgtaaagttccaggctatgcacgagttc
cagaacatccatgcgaaagccaaggaaaagatcaacgaattcgttcggggccatttttac
ggccacttcgactgggatctggacaacaccctctacctattcactgctggacgatacgag
ttcagaaacaagggtatcgatatgttcatcgagtcgttggcacgattgaacttccggttg
cagaagttaggctcgaatatcactgtcgttgctttcctcatccaccctgccgccacaaat
tcgtacaccatcgactcgctcaagggtcaggccgtgacgaagcagcttcatgataccgtc
accgagatccagaaccgtatagggtctcgcctgtttgacttggcggccaagtccaatggc
gacttttcgaagttccccaagacgtccgaccttctctcggacgaagacaagattcttctc
aagcgccgcatctttgcgctcaaacggaacagtctcccacctgttacgacgcacaacatg
gtggacgatgcgaacgacccgatcttgaaccagattcgccgcgtgaagctcttcaatgac
gcgcatgaccgggtcaaggtcgttttccatcccgactttttgagctccaacaaccccgtt
ctcggtctcgattacgaggaattcgtccgtggatgtcatctcggtgtcttccccagttat
tacgagccgtggggatacacgcccgccgaatgtacagtcatgggcatcccgtccgtgacg
accaacttgtctggcttcggatgcttcatgcaagacatgatcgaccgtcctgaagacgaa
ggttgctacatcatcgaccgccggatgcaatccgccgaagactccgtcaactccctcgcc
gactcgctcttctcattctcgcaaaagacccgtcggcagcgcattaaccagcgcaaccgc
gtcgaacgtctctctccgctcctcgactggaagaacctcgggatcgagtactccaaggcg
agacagttggcgctcaggagggcgtatccggacgcgtttgtgggtctgacgccgaatggg
atgggcgtggatggggaagaggaagatgagtttgatttcgagaagggcccggagaggttg
gcgttgagtatgccggggagtccgaggttcaaaatgggtgggctcgcgaccccgggagat
atgggaacgcttacggaggagatgcagactttgcatacgagcgattaccgtggctatgct
tggcctggttcgcaagaggaagacgacgacgcgtatcctttccccttggtcatgaaagtg
cgctctcgcgcgtcttcggtgatgtcaggtgcgagcacgccgggaggaggtcctttcaag
tccctcagcgagcgcgacttacagaaggccgacgccgcgctgtcgatggtgaatggaaac
ggaaacggaaacggaaatggggccttcaatggaaagtcgtcttga

DBGET integrated database retrieval system