KEGG   Stereum hirsutum: STEHIDRAFT_121051Help
Entry
STEHIDRAFT_121051 CDS       T03127                                 

Definition
(RefSeq) isocitrate dehydrogenase
  KO
K00031  
isocitrate dehydrogenase [EC:1.1.1.42]
Organism
shs  Stereum hirsutum
Pathway
Citrate cycle (TCA cycle)
Glutathione metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Peroxisome
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:shs00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    STEHIDRAFT_121051
  Metabolism of other amino acids
   00480 Glutathione metabolism
    STEHIDRAFT_121051
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    STEHIDRAFT_121051
Enzymes [BR:shs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     STEHIDRAFT_121051
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
LinkDB All DBs
Position
Unknown
AA seq 418 aa AA seqDB search
MYDKIAVKNPVVELDGDEMTRIIWKKIREELVLPYLDLDIKYYDLGVESRDATNDQVTVD
SANAILEYGVGIKCATITPDEARVQEFNLKQMWRSPNGTIRNILGGTVFREPIILDRIPR
PVPGWTNPIVIGRHAFGDQYRSTDFVAPGPGKIQLVYTPEGGGKPTVMDIYDFKGKGVAM
AMYNTDDSISGFAHSSFKMALAKKMPLFMSTKNTILKKYDGRFKDIFQEIYESQYKPEFE
KAGIYYEHRLIDDMVAQAIKSSGGFVWACKNYDGDVQSDILAQGFGSLGMMTSELITPDG
KVIESEAAHGTVTRHYREYQKGNETSTNPVASIFAWTRGLIHRAKLDSNTLLKEWAEELE
KSCVEVIDEDGVMTKDLALAIHGKGMKREHWVVTDVYMDAVKSKLDKKLAAKAKKSTS
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgtatgacaaaattgcggtgaagaacccggtggtcgagctcgatggagacgagatgacc
cgtatcatctggaagaagattcgtgaagagctcgtcctgccgtacttggacctggacatc
aagtactacgaccttggcgtggagagccgtgatgctaccaacgaccaagtcaccgtagac
tccgccaatgccattctcgaatacggtgttggtatcaagtgcgcgaccatcactcctgac
gaggctcgcgtccaggaattcaacctcaaacaaatgtggcgctcgcccaacggaaccatc
cgtaacatcctcggcggcaccgtcttccgtgaacccatcatcctcgaccgtatcccccgc
cccgtcccaggttggacaaaccccatcgtcatcggccgtcacgccttcggcgaccaatac
cgctcgacagacttcgtagcaccaggacccgggaagattcagttggtgtatacgccagag
ggaggaggaaagccgactgtcatggatatatatgatttcaagggcaagggtgtggcgatg
gcgatgtataacactgatgactcgatatcaggatttgcccactcttcgttcaagatggcg
ttggccaagaagatgccgctcttcatgtcgacgaagaacaccatcctcaagaagtacgac
ggccgcttcaaggacatcttccaggagatctacgaatcccaatacaagcccgaattcgaa
aaagccgggatctactacgaacatcgtctgatcgatgacatggtcgcgcaggccatcaag
tcctccggaggattcgtctgggcgtgcaagaactacgacggagacgtgcagtctgatatc
ctcgcacagggcttcggaagtttgggaatgatgacgagcgagttgatcacgcccgacggg
aaggtgatcgagagtgaggcggcgcacggaactgtcacccggcactaccgcgaataccaa
aaaggcaacgaaacgtccacgaaccccgtcgcgtccatcttcgcatggacccgtgggctc
atccaccgcgcgaaactcgattcgaacaccctgttgaaggagtgggcggaagagctggag
aagtcgtgtgtggaggtgattgatgaggacggggtgatgacgaaggatttggcgttggcg
atccatgggaaggggatgaagagggagcattgggtcgttacggatgtttatatggatgct
gtcaagagcaagctcgacaagaagctcgcggccaaggcgaagaagtccacctcgtga

DBGET integrated database retrieval system