KEGG   Sphingobacterium sp. ML3W: KO02_05655Help
Entry
KO02_05655        CDS       T03258                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sht  Sphingobacterium sp. ML3W
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sht00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KO02_05655
  Energy metabolism
   00680 Methane metabolism
    KO02_05655
Enzymes [BR:sht01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     KO02_05655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1268322..1270898
Genome map
AA seq 858 aa AA seqDB search
MKLSTKEAVFQNEVLTRFELFKSLFLTLPFQQVKDTGTLLPFFAKHCENGVEKHQTPEEI
INSFFEQHDIYSDEETQIDLLFRFVQYIERQVVLFDAIEDSSFKAIGKTDNSAQLGSLIK
SAEANPELKRKIVAKLKDFSVRLVLTAHPTQFYPGSVLSIINDLISAIKENDIHNIHLLL
QQLGKTPFINNNKPTPVDEAISLAWFLENVFYKVASEIQTYIDDELGIETAEVKQLIELG
FWPGGDRDGNPNVSAESTKKVATLLRTILFRCYYRDFRVVKRRITFRGVEKYMDNLQELF
YENSFNPVEAPIDETDNIIENLKAIQRVLHEDHNNLFVEIVDDLLRKVMTFGCFFTTLDI
RQDSSILTQTFDYITKKYPEETGVASGFGLLSEEDKQKNINFKELNLIFDDEATALEKDT
LEVIRLLKNIQKSGSERAAQRFIISNCQQASDILGLRQLFLWSGWTKDTLTIDFVPLFET
VDDLTRAADVMKSLYTNKEYAKHLKLRGNKQTIMLGYSDSTKDGGYLMANWSIYSAKIEL
TAIAREYGVDLVFFDGRGGPPARGGGKTQRFYASMGQEIANDHIQLTIQGQTISSQYGSL
DTARFNIEQLLHAGIISDLKQKSGDTLTPHQKGIVDRLADLSYNKFMDLRQNPLFLSYLE
TLSPLKVLSSINISSRPVKRNSDKELKLKDLRAISFVTAWSQLKQNIPGFYGVGTALKWA
EQNNLWKDVQQLYLSSGFFQTLIDNCMMSMTKSNFDITSYMQFDEKYGEFWKMLHEEFLV
TKAYLLKLSNTSKLMENYPIDRESILARENIVLPLLIIQHYAIKLINEGKLDEKKREIYA
KLIARTIYGVVNAGRNVA
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaagtacaaaagaagccgtttttcaaaacgaagttttgacgcgatttgaactt
ttcaaaagtttatttttaacactaccgtttcagcaagtaaaggatacaggtaccttattg
ccattttttgcaaagcattgtgaaaatggtgtagagaagcatcagacacctgaggaaatt
atcaatagcttttttgaacaacacgatatttattcggatgaggagactcagatcgattta
ttgtttcgttttgtgcaatatatagaaaggcaagttgttttgtttgatgcgattgaagat
tcgtcttttaaagcaataggtaagactgataattcagcgcagcttggttctttgattaaa
tcagctgaagctaatccggaacttaaaagaaaaatcgttgcgaaattaaaggatttttct
gttcgtttagtattgaccgctcatccaactcaattttacccgggctccgttttatcgatc
atcaatgatttaattagtgcaattaaagagaatgatattcacaatatccatttattattg
caacaattagggaaaactccttttatcaataataataaaccaactccagtagatgaagct
attagcttagcttggtttctggaaaatgtattttataaggttgcttcagaaattcagacc
tatatcgatgatgagttaggaatcgagactgctgaagtaaaacagttaattgagcttggt
ttttggcctggaggggatcgcgatggtaatccaaatgttagtgccgaaagtacaaaaaaa
gttgctacgttgttaagaacaattttgttccgttgttattatagggatttcagagttgtt
aagcgtcgtattacttttagaggggttgaaaaatatatggacaatctacaggaactgttt
tatgaaaatagtttcaatcctgttgaagctcctatcgatgagaccgacaatattattgaa
aacctaaaagctatacaaagggtacttcatgaagatcacaataatctttttgtagagatt
gtagatgatttattgcgtaaagtgatgactttcggttgtttctttacaacgttggatatt
cgccaagatagtagtattctgacacagacctttgattatatcactaagaaatatccagaa
gagacaggtgttgcatcaggatttggattgttgtctgaagaagataaacaaaaaaatatc
aattttaaggaattgaatctgatttttgatgatgaggctacggcattggaaaaagatacc
ctagaagtaatacgtttattaaagaatattcaaaaatcgggttctgagcgtgccgctcaa
cgatttattattagtaattgtcaacaagcaagtgatattttaggattacgacagttgttc
ctatggtcgggctggactaaagataccttgacgattgattttgtacccttatttgaaacc
gttgatgacttaactcgcgcggccgatgtgatgaaatcattgtataccaataaggaatat
gcaaagcatcttaaactgagagggaataagcaaacgattatgcttggttactctgatagt
acaaaagatggtggttatttgatggccaattggtctatttatagtgctaaaatagaattg
acagcaattgcgagagaatatggtgtggatctcgttttctttgatggtcgtggagggccg
cctgcaaggggaggaggtaagacacaaagattctatgcatccatgggacaggaaattgca
aatgatcatatacaattgaccattcagggacagaccatcagtagtcaatacggctcatta
gatacggctaggttcaatattgagcaattgctacatgctggtatcatttctgatctgaaa
caaaaatctggtgatacattgactccgcatcaaaagggcatagtggatcgtttagcagat
ttgagttacaataagtttatggatttacgtcaaaatccattgttcttaagttatttggag
accttatcacctttgaaagtactttcttcgatcaatatcagtagtcgtcctgttaaaagg
aattcagataaagaattgaagcttaaggatttgcgggccattagttttgtaactgcttgg
agtcaattgaaacaaaatattccaggtttttatggagtgggtacggcgcttaaatgggca
gagcaaaacaacctttggaaggatgtacagcaattgtatctgtcttcaggttttttccag
acgttaatcgataattgtatgatgtcgatgactaaatcgaactttgacattacatcttat
atgcagtttgatgaaaagtacggcgaattttggaaaatgctacatgaggagtttttggtt
accaaagcatacttgttgaagcttagcaatacatcaaaattaatggagaattaccctata
gatcgtgaatctatattggcgcgtgaaaatatcgtattgcctctattgataatacaacat
tatgctatcaaattaattaatgaaggcaaattagatgaaaagaaaagagaaatctatgct
aaattaattgctagaaccatctatggagtagtcaatgctggtagaaatgtggcataa

DBGET integrated database retrieval system