KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_2086Help
Entry
SHJG_2086         CDS       T02063                                 

Definition
(GenBank) putative ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
shy03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:shy00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    SHJG_2086
Enzymes [BR:shy01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SHJG_2086
DNA repair and recombination proteins [BR:shy03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     SHJG_2086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_OB_2 RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AEY87361
UniProt: H2JSJ6
LinkDB All DBs
Position
2542910..2543932
Genome map
AA seq 340 aa AA seqDB search
MTVSGVVEISAVTAVTLPLIPPMLATPGSLPPAAQDARWAYETKQDGQRVMVYLPGDGSV
LLRARSGEDITGAYPELRPLGGALGSTPAVLDGEVLALDARGRADFQLLQSRMGLAHAPA
RAARRAAQVPVHLVLFDVPHLEESLVRLPYVRRRARLEELALAGPYWSTPGAVTGHGAEA
LAATREHGLEGLVCKRLDSVYEPGVRSRAWIKIRNMRAEDVIVGGWLPGKGRLTGLPGAV
LVGQRDPEGRLRYVGGVGTGWSEAERVRLADLLRDTASDRCPFEPVPRVPGARWVLPRLV
GEVSYSTRTRNGMLRQPSWLRLRPDLTPEESAADLPGESG
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgacggtgtcgggggtggtcgagatctctgccgtgaccgccgtgaccctgccgctcatt
ccgccgatgctcgcgacgcccggcagcctgccgcccgccgcgcaggacgcgcggtgggcg
tacgagaccaagcaggacggccagcgggtgatggtgtacctgccgggcgacggcagtgtg
ctgctgcgcgcccgctcgggcgaggacatcaccggcgcctacccggagctccggccgctc
ggcggggcgctgggcagcacacccgcggtgctggacggggaggtgctggccctggacgcg
cggggccgggccgacttccagctcctccagagccggatgggcctcgcgcacgcccccgcg
cgggcggcgcgccgggccgcgcaggtcccggtgcacctggtgctgttcgacgtgccccat
ctggaggagtccctggtacggctgccatacgtccggcggcgggcgcggctggaggaactg
gcgctcgcggggccgtactggtcgacgccgggagcggtgaccgggcacggtgccgaggca
ctcgcggcgaccagggaacacggcctggagggcctggtgtgcaagcggctggactcggtg
tacgaacccggcgtgcgctcccgcgcctggatcaagatccggaacatgcgggccgaggac
gtgatcgtcggcggctggctgcccggcaaggggcggctgaccggactgcccggcgcggta
ctggtcggccagcgcgacccggagggcaggctgcggtacgtcggcggggtgggcaccggc
tggagcgaggccgagcgggtccggctggcggacctgctgcgggacacggcgagcgaccgg
tgccccttcgagcccgtgccgcgcgtgcccggcgcccggtgggtgctgccccggctggtg
ggcgaggtcagctacagcacccgtacccggaacggcatgctgcgccagccctcctggctg
cggctgcgcccggatctcactccggaggagtctgcggccgacctgcccggggaatccggc
tga

DBGET integrated database retrieval system