KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_6772Help
Entry
SHJG_6772         CDS       T02063                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SHJG_6772
   00650 Butanoate metabolism
    SHJG_6772
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SHJG_6772
   00280 Valine, leucine and isoleucine degradation
    SHJG_6772
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SHJG_6772
Enzymes [BR:shy01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SHJG_6772
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     SHJG_6772
Amino acid related enzymes [BR:shy01007]
 Aminotransferase (transaminase)
  Class III
   SHJG_6772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(7698873..7700207)
Genome map
AA seq 444 aa AA seqDB search
MTALPQERRVVTAIPGPKSQELQARRTAAVAQGVGSVLPVFTARAGGGIIEDVDGNRLID
FGSGIAVTSVGASAEAVVRRASAQLADFTHTCFMVTPYEGYVEVAEALAELTPGDHAKKS
ALFNSGAEAVENAVKIARAYTKRQAVVVFDHGYHGRTNLTMALTAKNMPYKHGFGPFAPE
VYRVPVAYAYRWPTGPDNAGPEAAAQAIDQITKQVGPDNVAAIIIEPVLGEGGFIEPAKG
FLPAIRQFAADNGIVFVADEIQSGFCRTGQWFACEDEGIVPDLITTAKGIAGGLPLAAVT
GRAEIMDAAHAGGLGGTYGGNPVACAGALGAIETMKELDLNGKAKRIEEIMKGRLTAMAE
KFDVIGDVRGRGAMIAIELVKDRATKEPNPEATAALAKACHAEGLLVLTCGTYGNVLRFL
PPLVIGEDLLNEGLDIIEQAFARI
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacttccgcaggagcgccgcgtcgtcaccgccatccccggtccgaagtcgcag
gagttgcaggcccgccgtaccgccgcggtcgcccagggcgtgggctccgtactgcccgtg
ttcaccgcgcgcgcgggcggcgggatcatcgaggacgtcgacggcaaccggctgatcgac
ttcggctccggcatcgccgtgacgagcgtcggcgcctccgccgaggccgtggtgcgccgc
gcgagcgcccagctcgccgacttcacccacacctgtttcatggtcaccccgtacgagggc
tacgtggaggtcgcggaggcgctcgccgagctgaccccgggtgaccacgccaagaagtcc
gcgctgttcaactccggcgccgaggccgtcgagaacgccgtcaagatcgcgcgtgcctac
accaagcggcaggccgtggtggtgttcgaccacgggtaccacgggcggaccaacctcacc
atggcgctgacggcgaagaacatgccgtacaagcacgggttcgggccgttcgcgcccgag
gtgtaccgggtgcccgtcgcgtacgcgtaccgctggccgaccggcccggacaacgccggc
ccggaggccgccgcgcaggccatcgaccagatcaccaagcaggtcggcccggacaacgtc
gccgcgatcatcatcgagccggtcctcggcgagggcggcttcatcgagcccgccaagggc
ttcctgccggcgatccgccagttcgccgccgacaacggcatcgtcttcgtcgccgacgag
atccagtccggtttctgccggaccgggcagtggttcgcgtgcgaggacgaggggatcgtg
cccgacctgatcacgaccgccaagggcatcgccggcggtctgccgctcgccgccgtgacc
gggcgcgccgagatcatggacgccgcgcacgccggcgggctcggtggtacgtacggcggc
aacccggtcgcgtgcgccggtgcgctcggcgccatcgagacgatgaaagagctggacctc
aacggcaaggccaagcgcatcgaggagatcatgaagggtcgcctcaccgccatggccgag
aagttcgacgtcatcggtgacgtgcgcggtcgcggtgccatgatcgcgatcgagctggtc
aaggaccgcgccaccaaggagccgaacccggaggccaccgccgcgctcgccaaggcctgc
cacgccgagggcctgctggtcctgacctgcggcacctacggcaacgtgctccgcttcctg
ccgccgctggtcatcggcgaggacctgctgaacgagggcctcgacatcatcgagcaggcg
ttcgcccgcatctga

DBGET integrated database retrieval system