KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_7610Help
Entry
SHJG_7610         CDS       T02063                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(8663241..8664317)
Genome map
AA seq 358 aa AA seqDB search
MDLPVMPPVKPMLAKSVAKIPPGMHYEAKWDGFRSIVFRDGAEVELGSRTGKPLTRYFPE
LVEALKERLPERCVLDGEIVIARGGRLDFDALTERIHPAASRVRMLAEKTPASFVAFDVL
ALDDHALLDVPLTDRRALLDRALAGATPPVHVAPSTTDIEVARQWFEQFEGAGLDGVVAK
PLTLRYLQDERAMFKIKHERTADVVVAGYRFHKSGPVVGSLLLGLYDEQGRLQHVGVSAA
FSMKKRAELVEELEPLRMDDVSGHPWAAWTDETAHETARLPGAPSRWSGKKDLSWVPLRP
DRVAEVAYDHMENGQRFRHTARFRRWRPDRTPESCTYAQLQEPVRYDLAEILGEKDGG
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggatctgcccgtcatgccgcccgtgaagccgatgctcgccaagtcggtggcgaagatc
ccgccggggatgcactacgaggccaagtgggacggcttccggtcgatcgtgttccgggac
ggggccgaggtcgaactgggcagccgcaccggaaagccgctgaccaggtacttccccgag
ctggtcgaggcgctgaaggagcggctgcccgagcggtgcgtgctggacggggagatcgtc
atcgcgcggggcggccggctggacttcgacgcgctgaccgagcggatccacccggcggcc
tcccgggtacggatgctggcggagaagaccccggcctccttcgtcgccttcgacgtgctc
gccctggacgaccacgccctgctcgacgtgccgctcaccgaccgccgcgccctgctggac
cgggccctggccggggcgaccccgccggtgcacgtggcgccgtcgacgaccgacatcgag
gtggcccggcagtggttcgagcagttcgaaggcgccggtctcgacggggtcgtcgccaag
ccgctcaccttgcgctacctccaggacgagcgggccatgttcaagatcaagcacgagcgc
acggcggacgtcgtcgtcgccgggtaccgcttccacaaaagcggcccggtggtgggctcg
ctgctgctggggctgtacgacgagcagggccggctccagcacgtgggcgtgtcggccgcg
ttctccatgaagaagcgcgccgagctggtcgaggagctggagccgctgcgcatggacgac
gtctccgggcacccgtgggccgcctggacggacgagaccgcgcacgagacggcccggctg
ccgggcgcgccgagccgctggtcgggcaagaaggacctgtcctgggtgccgctgcggccg
gaccgggtggccgaggtggcgtacgaccacatggagaacggccagcggttccggcacacg
gcccgcttccgccgctggcgcccggaccgcacaccggagagctgcacgtacgcccagctc
caggagccggtccggtacgacctcgcggagatcctcggcgagaaggacggcggctga

DBGET integrated database retrieval system