KEGG   Shinella sp. HZN7: shn_08580Help
Entry
shn_08580         CDS       T04278                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
shz  Shinella sp. HZN7
Pathway
shz00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:shz00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    shn_08580
Enzymes [BR:shz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     shn_08580
Transporters [BR:shz02000]
 Other Transporters
  Pores ion channels [TC:1]
   shn_08580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: ANH04086
UniProt: A0A1A9FZ14
LinkDB All DBs
Position
complement(1769613..1770248)
Genome map
AA seq 211 aa AA seqDB search
MAEELVFYSNPMSRGRIARWMLEEVGAPYRIEWLTFDGSMKSPEFLAINPMGKVPTIRHG
ETVVTEAAAICAYLADAFPEAGLAPPVEKRGDYYRWLFFAAGPLEMAVSLKAFGIEVPRE
RERSIGCGSYGAVMDSLSLAVTRQPYITGESFTAADVYVGAHISWGLQFGSLEPRPEFKA
YWDRLKERPASKRATALDDEEMHRQLQAAKG
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggaactggttttctatagcaacccgatgtcgcgcggacgcatcgcccgctgg
atgctggaggaggtcggcgcgccctaccgcatcgaatggctgaccttcgacggctcgatg
aagtcgccggaattcctggcgatcaacccgatgggcaaggtaccgaccatccgccacggc
gagaccgtggtgacggaagcggcggcgatctgcgcctatctcgccgatgccttccccgaa
gccggcctcgccccgccggtcgagaagcgcggcgattactaccgctggctcttcttcgcc
gccggcccgctggaaatggcggtctcgctgaaggccttcggcatcgaggttcccagggag
cgcgagcgcagcatcggctgcggcagctatggcgcggtgatggacagcctgtcgctggcc
gtcacgcgccagccctacatcaccggcgagagctttaccgccgccgatgtctatgtcggc
gcccatatcagctggggcctgcaattcggctcgctggagcctcggccggaattcaaggcc
tattgggaccgcctgaaggagcggccggccagcaagcgcgcgaccgccctcgacgacgag
gagatgcaccgccagctccaggcggcgaagggttag

DBGET integrated database retrieval system